Amylin (1-37), human, amide;KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2(Disulfidebridge:2-7)

Published date: 2019-08-30 15:58:56

Amylin (1-37), human, amide;KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2(Disulfidebridge:2-7) Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Amylin (human) trifluoroacetate salt CAS# 122384-88-7
Price ¥Inquiry/1kg ¥Inquiry/100g Purity 98.0%
Stocking
Period
Inquiry Stock In Stock
 Detail Product Information
cassie.zhong@glbiochem.com| Amylin (1-37), human, amide;KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2(Disulfidebridge:2-7)
| 122384-88-7
cassie.zhong@glbiochem.com, 021-61263342, QQ3013744233
25g;100g;1kg;5kg Packaging
GL Biochem supplies all kinds of chemicals for peptide synthesis, including Fmoc Amino Acids, Coupling Reagents, Resins, etc.
Fmoc-L-Amino Acid   Fmoc-D-Amino Acid  
Product Name CAS # Product Name CAS #
Fmoc-Ala-OH 35661-39-3 Fmoc-D-Ala-OH 79990-15-1
Fmoc-Arg(Pbf)-OH 154445-77-9 Fmoc-D-Arg(Pbf)-OH 187618-60-0
Fmoc-Asn(Trt)-OH 132388-59-1 Fmoc-D-Asn(Trt)-OH 180570-71-2
Fmoc-Asp(OtBu)-OH 71989-14-5 Fmoc-D-Asp(OtBu)-OH 112883-39-3
Fmoc-Cys(Trt)-OH 103213-32-7 Fmoc-D-Cys(Trt)-OH 167015-11-4
Fmoc-Gln(Trt)-OH 132327-80-1 Fmoc-D-Gln(Trt)-OH 200623-62-7
Fmoc-Glu(OtBu)-OH 71989-18-9 Fmoc-D-Glu(OtBu)-OH 104091-08-9
Fmoc-Gly-OH 29022-11-5    
Fmoc-His(Trt)-OH 109425-51-6 Fmoc-D-His(trt)-OH 135610-90-1
Fmoc-Ile-OH 71989-23-6 Fmoc-D-Allo-Ile-OH 118904-37-3
Fmoc-Leu-OH 35661-60-0 Fmoc-D-Leu-OH 114360-54-2
Fmoc-Lys(Boc)-OH 71989-26-9 Fmoc-D-Lys(Boc)-OH 92122-45-7
Fmoc-Met-OH 71989-28-1 Fmoc-D-Met-OH 112883-40-6
Fmoc-Phe-OH 35661-40-6 Fmoc-D-Phe-OH 86123-10-6
Fmoc-Pro-OH 71989-31-6 Fmoc-D-Pro-OH 101555-62-8
Fmoc-Ser(tBu)-OH 71989-33-8 Fmoc-D-Ser(tBu)-OH 128107-47-1
Fmoc-Thr(tBu)-OH 71989-35-0 Fmoc-D-Thr(tBu)-OH 138797-71-4
Fmoc-Trp(Boc)-OH 143824-78-6 Fmoc-D-Trp(Boc)-OH 163619-04-3
Fmoc-Tyr(tBu)-OH 71989-38-3 Fmoc-D-Tyr(tBu)-OH 118488-18-9
Fmoc-Val-OH 68858-20-8 Fmoc-D-Val-OH 84624-17-9
Coupling Reagents      
DCC 538-75-0 BOP Reagent 56602-33-6
EDC•HCl 25952-53-8 BOP Cl 68641-49-6
HATU 148893-10-1 DEPBT 165534-43-0
HBTU 94790-37-1 HCTU 330645-87-9
TDBTU 125700-69-8 DPPA (Kg) 26386-88-9
TATU 873798-09-5 TSTU 105832-38-0
TBTU 125700-67-6 PyBOP 128625-52-5
TCTU 330641-16-2 PyBrOP 132705-51-2
Resins   Fmoc-Lys with Methyl  
2-Chlorotrityl Resin Knorr-2-Chlorotrityl Resin Fmoc-Lys(Boc,Me)-OH 951695-85-5
Wang Resin Rink Amide-AM Resin Fmoc-Lys(Me2)-OH 252049-10-8
DHP HM Resin Rink Amide-MBHA Resin Fmoc-Lys(Me3)-OH .HCL 201004-29-7
HMPA-AM Resin Sieber Amide Resin
Hydroxymethyl Resin Weinreb AM Resin
Manufactured by GL Biochem please contact us for consultation or order:
cassie.zhong@glbiochem.com, 021-61263342, QQ3013744233

cassie.zhong@glbiochem.com| Amylin (1-37), human, amide;KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2(Disulfidebridge:2-7)
| 122384-88-7
cassie.zhong@glbiochem.com, 86-21-61263342, QQ3013744233
More

Supplier/Manufacture

GL Biochem (Shanghai) Ltd.

Chemsrc Level: Unverified
Tel: 021-61263452
Address: No.519 Ziyue Road, Shanghai, 200241, China
Area: China
Contact: Jackie Yang
Contact Phone #: 13641803416
Email: ymbetter@glbiochem.com
Website: http://www.glbiochem.com
Annual Trade Volume: 2000000000RMB
Foreign Trade % of Sales: 65%
Major partners:
During the past 20 years, GL Biochem has been recognized with many ‎scientific and technological achievement awards at Provincial and Country levels, 20 Chinese patents, and published over 20 papers in scientific journals.

GL Biochem utilizes many state-of-the-art and highly sophisticated peptide instruments able to produce more than 10,000 peptides per month. Our machines include 400Hz NMR, 2 units of FT-IR, 10 units of MS, Amino Acid Analyzer, 96/102 well automated peptide synthesizers, microwave-assisted peptide synthesizers, microplate readers, and 200 units of analytical and preparative HPLC.

GL Biochem has become the largest and most recognized producer of peptide reagents, custom peptides and antibodies worldwide. We are renowned among international and domestic customers for having the most complete listing of peptide related products ever offered! In addition we stock standard products and can usually produce a custom peptide in less than 2 weeks.

As part of our expansion plans, GL Biochem has successfully acquired an antibody manufacturing company in 2008 and added fast-growing antibody products into our business portfolio. In 2011, we also acquired an Australian peptide company. This acquisition not only further substantiated our position as the top ranking peptide company in the world, but also enlarged our technical and sales superiority in the peptide business arena!

We would like to express our appreciation for the support given by our Chinese government. Top National Chinese leaders such as Mr. Jiang Zemin, Mr. Hu Jintao, Mr. Xi Jinping have visited GL Biochem or met with GL Biochem senior management. The government of China has recognized how critical peptide research is to Chinese researchers along with all researchers worldwide and is committed to supporting us.
Top Suppliers:



Get all suppliers by the below link:

Amylin (human) trifluoroacetate salt suppliers


Price: $200/500ug
Price from the other suppliers:
2024-07-15 Amylin (human) trifluoroacetate salt
Price: Inquiry
2019-03-05 Amylin (human) trifluoroacetate salt
Price: ¥2088.0
2024-01-09 AMYLIN (1-37), HUMAN
Price: $Inquiry
2021-02-06 Amylin
Price: ¥5209.0

Get all price from the following link:

Amylin (human) trifluoroacetate saltprice