Urocortin III (mouse) trifluoroacetate salt

Published date: 2024-01-15 16:39:21

Urocortin III (mouse) trifluoroacetate salt Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Urocortin III (mouse) trifluoroacetate salt CAS# 357952-10-4
Price ¥3010.0/5mg ¥3640.0/10mg ¥4410.0/50mg ¥5600.0/100mg Purity 98.0%
Stocking
Period
7 Day Stock 需询单
 Detail Product Information
Chemical & Physical Properties:
CAS Number: 357952-10-4
Name: Urocortin III (mouse) trifluoroacetate salt
Molecular Formula: C186H312N52O52S2
Molecular Weight: 4172.97
Density: 1.0±0.1 g/cm3
Boiling Point: 536.7±23.0 °C at 760 mmHg
Melting Point: N/A
Flash Point: 292.4±19.1 °C

Supplier/Manufacture

Fuzhou Feijing Biological Technology Co., LTD

Chemsrc Level: Unverified
Tel: 0591-22822350
Address: 7F4, Guanpeng Park, No. 28, Xinghu Road, Nanyu Town
Area: China
Contact: Xiao Fei
Contact Phone #: 18059081430
Email: 2070812664@qq.com
Website: http://www.phygene.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Phygene is an integrated provider of life science research services and manufacturing, with products and services covering all key scientific research institutions. At present, it has 2500 square meters of research and production base, and is equipped with 100,000 aseptic working areas. It is a national high-tech enterprise and a science and technology small and medium-sized enterprise in Fujian Province. Since its establishment in 2015, it has focused on the development of efficient detection kits, polypeptide reagents, standard solutions, ready-to-use reagents and cost-effective experimental consumables, and its products have been widely involved in the scientific research fields of life science, agricultural biotechnology, pharmaceutical and industry, innovative medical treatment, petrochemical industry, and water quality testing. Our mission is to help our customers accelerate research in science, turn theoretical opportunities into productivity, and make research easier.

The company has passed ISO9001 quality management system certification, and has maintained long-term cooperative relations with many domestic and foreign universities and research institutions. The products involved are widely used by well-known universities and research institutes such as Chinese Academy of Sciences, Tsinghua University, Peking University, Fudan University, Zhejiang University, Lanzhou University, Nanjing University, Southeast University, Xiamen University, etc. Many research papers using Phygene products have been published, including publication in international high-level academic journals such as Cell, Nature, and Science.

Phygene's product line covers a variety of reagents and kits in molecular biology, cell biology, immunology, proteomics, peptide synthesis, biomedicine, standard titrations, ready-to-use reagents and other fields.
Top Suppliers:

Get all suppliers by the below link:

Urocortin III (mouse) trifluoroacetate salt suppliers

Price from the other suppliers:
2018-01-29 Urocortin III
Price: $Inquiry
2021-07-26 FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Price: $Inquiry
2024-05-30 Urocortin III (mouse) trifluoroacetate salt
Price: $Inquiry
2020-10-30 Urocortin III, mouse
Price: ¥Inquiry

Get all price from the following link:

Urocortin III (mouse) trifluoroacetate saltprice