Cagrilintide 99% White powder High Quality Cagrilintide weight loss GIPR/GLP-1R/GCRG Peptide

Published date: 2024-12-10 10:49:41

Cagrilintide 99% White powder High Quality Cagrilintide weight loss GIPR/GLP-1R/GCRG Peptide Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Cagrilintide CAS# 1415456-99-3
Price ¥Inquiry/1kg ¥Inquiry/1g ¥Inquiry/1mg ¥Inquiry/1ton Purity 99.0%
Stocking
Period
1 Day Stock In Stock
Product Webpage: https://peptidee.com/index.php/product/cagrilintide/
 Detail Product Information
Cagrilintide Overview
Cagrilintide is a potent long-acting acylated amylin analogue that effectively targets amylin receptors (AMYR) and calcitonin G protein-coupled receptors (CTR). It has been shown to induce significant weight loss and reduce food intake, making it a highly promising compound for obesity treatment. In vivo studies have demonstrated Cagrilintide’s efficacy in reducing food intake in animal models, with sustained effects over several days. Currently, Cagrilintide is being used in clinical settings to explore its full potential in addressing obesity and related metabolic conditions.

Product Details
Sequence:{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
Sequence Shortening:{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Molecular Formula:C194H312N54O59S2
Molecular Weight:01 g/mol
CAS Number:1415456-99-3
Research Highlights
Weight Loss Efficacy:Cagrilintide has demonstrated significant weight loss potential, reducing food intake in animal studies with sustained effects at doses ranging from 1-10 nmol/kg.
Pharmacokinetics:Cagrilintide exhibits favorable pharmacokinetic properties, delivering effective results when administered subcutaneously or intravenously.
Clinical Application:Cagrilintide is actively used in clinical trials to further assess its efficacy in treating obesity, overweight conditions, and related metabolic disorders.
Obesity Treatment Potential:With its dual mechanism of action, Cagrilintide is positioned as a leading option in the fight against obesity, offering a new and promising approach to weight management.
Important Notices:
This product is sold for scientific research purposes only.

Supplier/Manufacture

Zhangzhou Weiming Boxin Medical Biology Co., LTD

Chemsrc Level: Unverified
Tel: 0596-6070300
Address: 518 Nanbin Dadao, Zhangzhou Development Zone, Fujian Province, China
Area: China
Contact: Rocky
Contact Phone #: 18750546777
Email: SINOPEPT@GMAIL.COM
Website: http://www.peptidee.com
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Zhangzhou Weiming Boxin Biomedical Co., Ltd. was founded in 2011, located in Zhangzhou Development Zone, Fujian Province, with 20 mu polypeptide production base. It is one of the first high-tech enterprises in China with the core technology of peptide synthesis and modification, and has advanced and efficient peptide drug process research and development and large-scale production capacity. The company has 6000 square meters of cGMP plant, first-class peptide synthesis, purification, lyophilization, quality testing and analysis and other precision instruments. Since its establishment, the company has been providing high-quality, inexpensive and high-tech peptides for pharmaceutical enterprises, biotechnology companies, universities and scientific research institutions at home and abroad by utilizing its high-throughput peptide synthesis platform with independent intellectual property rights.
Top Suppliers:

Get all suppliers by the below link:

Cagrilintide suppliers

Price from the other suppliers:
2024-07-15 Cagrilintide acetate
Price: Inquiry
2024-05-30 Cagrilintide
Price: $Inquiry
2024-09-14 Cagrilintide weight-loss peptide
Price: ¥Inquiry

Get all price from the following link:

Cagrilintideprice