106686-61-7

106686-61-7 structure
106686-61-7 structure

Name Amyloid β-Protein Fragment 1-28
Synonyms Amyloid |A-Protein Fragment 1-28
DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
(Gln11)-Amyloid β-Protein (1-28)
[Gln11]-beta-Amyloid (1-40)
Molecular Formula C145H209N41O46
Molecular Weight 3262.46000
Exact Mass 3260.53000
PSA 1419.67000
LogP 1.29040
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.