285554-31-6

285554-31-6 structure
285554-31-6 structure
  • Name: Amyloid β-Protein (1-46)
  • Chemical Name: Amyloid beta-Protein (1-46)
  • CAS Number: 285554-31-6
  • Molecular Formula: C223H347N59O65S
  • Molecular Weight: 4926.56
  • Catalog: Research Areas Others
  • Create Date: 2018-02-13 08:00:00
  • Modify Date: 2025-08-26 17:40:12
  • Amyloid β-Protein (1-46) is aAβ Fragment.

Name Amyloid beta-Protein (1-46)
Synonyms BETA-AMYLOID (1-46)
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH
AMyloid b-Protein (1-46)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV
Amyloid beta-Protein (1-46)
Description Amyloid β-Protein (1-46) is aAβ Fragment.
Related Catalog
Molecular Formula C223H347N59O65S
Molecular Weight 4926.56
Exact Mass 4925.545
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.