93755-85-2

93755-85-2 structure
93755-85-2 structure
  • Name: GRP (human)
  • Chemical Name: Gastrin Releasing Peptide human
  • CAS Number: 93755-85-2
  • Molecular Formula: C130H204N38O31S2
  • Molecular Weight: 2859.377
  • Catalog: Peptides
  • Create Date: 2018-02-20 08:00:00
  • Modify Date: 2025-08-23 10:48:55
  • Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.

Name Gastrin Releasing Peptide human
Synonyms MFCD00133362
L-Valyl-L-prolyl-L-leucyl-L-prolyl-L-alanylglycylglycylglycyl-L-threonyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-methionyl-L-tyrosyl-L-prolyl-L-arginylglycyl-L-asparaginyl-L-histidyl-L-tryptophyl-L-alanyl-L-valylglycyl-L-histidyl-L-leucyl-L-methioninamide
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Gastrin-Releasing Peptide, human
Description Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
Related Catalog
In Vitro Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. However, GRP/bombesin-like immunoreactivity is widely distributed in mammalian brain, especially the hypothalamus, GI tract and in human fetal lung[1].
References

[1]. Dubovy SR, et al. Expression of hypothalamic neurohormones and their receptors in the human eye. Oncotarget. 2017 Jun 3.

Density 1.5±0.1 g/cm3
Molecular Formula C130H204N38O31S2
Molecular Weight 2859.377
Exact Mass 2857.499512
LogP -1.40
Index of Refraction 1.672
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.