Top Suppliers:I want be here

11118-25-5

11118-25-5 structure
11118-25-5 structure
  • Name: Calcitonin (rat) trifluoroacetate salt
  • Chemical Name: Calcitonin rat
  • CAS Number: 11118-25-5
  • Molecular Formula: C148H228N40O46S3
  • Molecular Weight: 3399.83
  • Catalog: Biochemical Peptide
  • Create Date: 2018-06-24 20:34:09
  • Modify Date: 2025-08-20 11:25:11
  • Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1].

Name Calcitonin rat
Synonyms CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2
CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7)
Description Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1].
Related Catalog
References

[1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.

Molecular Formula C148H228N40O46S3
Molecular Weight 3399.83
Exact Mass 3397.59000
PSA 1455.73000
Appearance powder
Storage condition −20°C
WGK Germany 3
HS Code 3822009000
HS Code 3822009000
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.