11118-25-5
11118-25-5 structure
- Name: Calcitonin (rat) trifluoroacetate salt
- Chemical Name: Calcitonin rat
- CAS Number: 11118-25-5
- Molecular Formula: C148H228N40O46S3
- Molecular Weight: 3399.83
- Catalog: Biochemical Peptide
- Create Date: 2018-06-24 20:34:09
- Modify Date: 2025-08-20 11:25:11
-
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1].
| Name | Calcitonin rat |
|---|---|
| Synonyms |
CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2
CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7) |
| Description | Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1]. |
|---|---|
| Related Catalog | |
| References |
[1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54. |
| Molecular Formula | C148H228N40O46S3 |
|---|---|
| Molecular Weight | 3399.83 |
| Exact Mass | 3397.59000 |
| PSA | 1455.73000 |
| Appearance | powder |
| Storage condition | −20°C |
| WGK Germany | 3 |
|---|---|
| HS Code | 3822009000 |
| HS Code | 3822009000 |
|---|