α-Endorphin structure
|
Common Name | α-Endorphin | ||
---|---|---|---|---|
CAS Number | 59004-96-5 | Molecular Weight | 1745.95000 | |
Density | N/A | Boiling Point | N/A | |
Molecular Formula | C77H120N18O26S | Melting Point | N/A | |
MSDS | USA | Flash Point | N/A |
Name | α-ENDORPHIN |
---|---|
Synonym | More Synonyms |
Molecular Formula | C77H120N18O26S |
---|---|
Molecular Weight | 1745.95000 |
Exact Mass | 1744.83000 |
PSA | 744.12000 |
Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
---|---|
Safety Phrases | S22-S24/25 |
RIDADR | NONH for all modes of transport |
WGK Germany | 3 |
Live cell monitoring of mu-opioid receptor-mediated G-protein activation reveals strong biological activity of close morphine biosynthetic precursors.
J. Biol. Chem. 282 , 27126-32, (2007) G-protein activation by receptors is generally measured using (35)S-GTPgammaS binding assays in cell membranes and cannot be well assessed in intact cells. We have recently developed a fluorescence re... |
|
gamma endorphin, alpha endorphin and Met-enkephalin are formed extracellularly from lipotropin C fragment.
Nature 269(5629) , 619-21, (1977)
|
|
Selective conversion of beta-endorphin into peptides related to gamma- and alpha-endorphin.
Nature 283(5742) , 96-7, (1980) beta-Endorphin (beta-LPH61-91) is a well known endogenous opioid ligand. It and related peptides have recently been implicated in the control of adaptive behaviour. Smaller beta-endorphin fragments ap... |
YGGFMTSEKSQTPLVT |
alpha-Endorphin |
LPH(61-76) |
a-Endorphin |
A-ENDORPHIN HUMAN |
EINECS 262-330-3 |
MFCD00076381 |
Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr |
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |