ACTH (7-38) (human)

Suppliers

Names

[ CAS No. ]:
68563-24-6

[ Name ]:
ACTH (7-38) (human)

[Synonym ]:
Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE

Chemical & Physical Properties

[ Molecular Formula ]:
C167H257N47O46

[ Molecular Weight ]:
3659.11

Safety Information

[ Personal Protective Equipment ]:
Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter

[ RIDADR ]:
NONH for all modes of transport

Articles

Gastric inhibitory polypeptide stimulates glucocorticoid secretion in rats, acting through specific receptors coupled with the adenylate cyclase-dependent signaling pathway.

Peptides 20(5) , 589-94, (1999)

Gastric inhibitory polypeptide (GIP) is a 42-amino acid peptide, belonging to the VIP-secretin-glucagon superfamily, some members of this group are able to regulate adrenocortical function. GIP-recept...

Evidence that an extrahypothalamic pituitary corticotropin-releasing hormone (CRH)/adrenocorticotropin (ACTH) system controls adrenal growth and secretion in rats.

Cell Tissue Res. 272(3) , 439-45, (1993)

Within two weeks, hypophysectomy induced in rats a striking decrease in the level of circulating ACTH (the concentration of which was at the limit of sensitivity of our assay system), coupled with a n...

Adrenocorticotrophic hormone modulates Escherichia coli O157:H7 adherence to porcine colonic mucosa.

Stress 8(3) , 185-90, (2005)

Exposure to stress is associated with susceptibility to disease and one stress mediator, norepinephrine, has been reported to enhance the adherence of enterohemorrhagic Escherichia coli O157:H7 (EHEC)...


More Articles

Related Compounds

  • ACTH (7-16)NH2
  • acth (7-39)
  • ACTH (7-10)
  • pTH (1-38) (human)
  • pTH (1-38) (human)
  • PACAP(6-38), human, ovine, rat
  • 2-(5-Fluoro-4-methyl-2-nitrophenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane
  • 2-Chloro-N-(cyclopropylmethyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzamide
  • 7-Bromo-2-methyl-1,3-benzoxazole-4-boronic acid, pinacol ester
  • 4-[(N-BOC-Azetidin-3-yl)sulfanyl]phenylboronic acid, pinacol ester
  • 4-Fluoro-3-(pyrrolidinomethyl)phenylboronic acid pinacol ester
  • 4-Fluoro-3-(morpholinomethyl)phenylboronic acid pinacol ester
  • 4-Fluoro-3-(N-isopropylaminomethyl)phenylboronic acid pinacol ester
  • 3-(N-Butylaminomethyl)-4-fluorophenylboronic acid pinacol ester
  • Methyl 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)furan-3-carboxylate
  • 1-[4-(Tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]pent-4-en-1-one