Cecropin B

Suppliers

Names

[ CAS No. ]:
80451-05-4

[ Name ]:
Cecropin B

[Synonym ]:
H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

Chemical & Physical Properties

[ Molecular Formula ]:
C176H302N52O41S

[ Molecular Weight ]:
3834.67

[ Storage condition ]:
-20°C

Safety Information

[ Personal Protective Equipment ]:
Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter

[ Hazard Codes ]:
Xi

[ RIDADR ]:
NONH for all modes of transport

[ WGK Germany ]:
3.0

Articles

Transcriptional analysis of a Photorhabdus sp. variant reveals transcriptional control of phenotypic variation and multifactorial pathogenicity in insects.

Appl. Environ. Microbiol. 77 , 1009-20, (2011)

Photorhabdus luminescens lives in a mutualistic association with entomopathogenic nematodes and is pathogenic for insects. Variants of Photorhabdus frequently arise irreversibly and are studied becaus...

Comparative mode of action of novel hybrid peptide CS-1a and its rearranged amphipathic analogue CS-2a.

FEBS J. 279(20) , 3776-90, (2012)

Cell selective, naturally occurring, host defence cationic peptides present a good template for the design of novel peptides with the aim of achieving a short length with improved antimicrobial potenc...

Surface functionalization of titanium substrates with cecropin B to improve their cytocompatibility and reduce inflammation responses.

Colloids Surf. B Biointerfaces 110 , 225-35, (2013)

Bacteria-related inflammation is a common postoperative complication in orthopedic implantation. In this study, cecropin B (CecB), a cationic peptide, was immobilized onto the surfaces of titanium sub...


More Articles


Related Compounds

  • Cecropin B (free acid) trifluoroacetate salt
  • Coralloidin B
  • Benzo[b]selenophen-3(2H)-one
  • dubioside B
  • box B-binding factor 2
  • chloropolysporin B
  • N-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-2-(2-(3,4-dimethoxyphenyl)-4-oxo-3,4-dihydrobenzo[b][1,4]thiazepin-5(2H)-yl)acetamide
  • N-(2-ethoxyphenyl)-2-(4-oxo-2-(3,4,5-trimethoxyphenyl)-3,4-dihydrobenzo[b][1,4]thiazepin-5(2H)-yl)acetamide
  • 5-(2-methyl-2,3-dihydro-1H-indol-1-yl)-3-(phenylsulfonyl)[1,2,3]triazolo[1,5-a]quinazoline
  • N-benzyl-7-chloro-3-[(3,4-dimethylphenyl)sulfonyl]-N-ethyl[1,2,3]triazolo[1,5-a]quinazolin-5-amine
  • 3-[(4-bromophenyl)sulfonyl]-N-(2-methoxybenzyl)[1,2,3]triazolo[1,5-a]quinazolin-5-amine
  • 5-(4-Ethylphenyl)pyridin-2-amine
  • N,N-Dimethyl-2-[(3-methylbutan-2-yl)amino]acetamide
  • N-[(4-fluorophenyl)methyl]-7-methyl-4-oxo-4H-pyrido[1,2-a]pyrimidine-3-carboxamide
  • N-(2-fluorophenyl)-7-methyl-4-oxo-4H-pyrido[1,2-a]pyrimidine-3-carboxamide
  • N-(3-chloro-4-methylphenyl)-7-methyl-4-oxo-4H-pyrido[1,2-a]pyrimidine-3-carboxamide
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.