Corticotropin Releasing Factor (148-188), ovine

Suppliers

Names

[ CAS No. ]:
9015-71-8

[ Name ]:
Corticotropin Releasing Factor (148-188), ovine

[Synonym ]:
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Corticotropin Releasing Factor (148-188), ovine

Chemical & Physical Properties

[ Molecular Formula ]:
C₂₀₅H₃₃₉N₅₉O₆₃S

[ Molecular Weight ]:
4670.38

[ Storage condition ]:
-20°C

Safety Information

[ Personal Protective Equipment ]:
Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter

[ Hazard Codes ]:
Xi

[ RIDADR ]:
NONH for all modes of transport

[ WGK Germany ]:
3.0

Articles

Neurokinin B signaling in the female rat: a novel link between stress and reproduction.

Endocrinology 155(7) , 2589-601, (2014)

Acute systemic stress disrupts reproductive function by inhibiting pulsatile gonadotropin secretion. The underlying mechanism involves stress-induced suppression of the GnRH pulse generator, the funct...

Expression and regulation of neuromedin B in pituitary corticotrophs of male melanocortin 2 receptor-deficient mice.

Endocrinology 155(7) , 2492-9, (2014)

The hypothalamic-pituitary-adrenal (HPA) axis is a major part of the neuroendocrine system that controls responses to stress, and has an important function in the regulation of various body processes....

Bisphenol A differentially activates protein kinase C isoforms in murine placental tissue

Toxicol. Appl. Pharmacol. 269(2) , 163-8, (2013)

Bisphenol A is utilized to make polycarbonate plastics and is an environmental pollutant. Recent research has indicated that it is an endocrine disruptor and may interfere with reproductive processes....


More Articles


Related Compounds

  • [Tyr0] Corticotropin Releasing Factor, ovine
  • Corticotropin-Releasing Factor, human, rat
  • CRF (ovine)
  • [DPro5] Corticotropin Releasing Factor, human, rat
  • CRF (6-33)
  • CRF (bovine) trifluoroacetate salt
  • 5-Chloro-4-[4-(3-chlorophenyl)piperazine-1-carbonyl]-2-(propylsulfanyl)pyrimidine
  • N-(1,1-dioxidotetrahydrothiophen-3-yl)-N-(2-fluorobenzyl)-3-methylbenzamide
  • 5-chloro-N-(1,1-dioxidotetrahydrothiophen-3-yl)-N-(2-fluorobenzyl)-3,6-dimethyl-1-benzofuran-2-carboxamide
  • N-(4-tert-butylbenzyl)-N-(1,1-dioxidotetrahydrothiophen-3-yl)-7-methyl-4-oxo-4H-chromene-2-carboxamide
  • N-{4-[(3,4-dimethyl-1,2-oxazol-5-yl)sulfamoyl]phenyl}-6,7-dimethyl-4-oxo-4H-chromene-2-carboxamide
  • 6-chloro-4-oxo-N-{3-[(tetrahydrofuran-2-ylmethyl)carbamoyl]-5,6-dihydro-4H-cyclopenta[b]thiophen-2-yl}-4H-chromene-2-carboxamide
  • 5-(Sec-butylsulfonyl)-2-(4-fluorophenyl)-4-[(4-fluorophenyl)sulfonyl]-1,3-oxazole
  • N-(5-chloro-2-methoxyphenyl)-6,8-dimethyl-4-oxo-4H-chromene-2-carboxamide
  • 6,8-dimethyl-N-(4-methylbenzyl)-4-oxo-4H-chromene-2-carboxamide
  • N-(3-chloro-2-methylphenyl)-7,8-dimethyl-4-oxo-4H-chromene-2-carboxamide
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.