Top Suppliers:I want be here

100040-31-1

100040-31-1 structure
100040-31-1 structure
  • Name: Gastric Inhibitory Polypeptide (human)
  • Chemical Name: Gastric Inhibitory Polypeptide human
  • CAS Number: 100040-31-1
  • Molecular Formula: C226H338N60O66S
  • Molecular Weight: 4983.53
  • Catalog: Peptides
  • Create Date: 2018-03-23 08:00:00
  • Modify Date: 2024-01-02 02:39:30
  • Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.

Name Gastric Inhibitory Polypeptide human
Synonyms MFCD00081634
GIP, human
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Gastric Inhibitory Peptide (GIP), human
Description Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.
Related Catalog
In Vitro Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state,sup>[1].
References

[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13.

Molecular Formula C226H338N60O66S
Molecular Weight 4983.53
Storage condition -20°C
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes Xn
RIDADR NONH for all modes of transport
WGK Germany 3.0