Parathyroid hormone (1-34) (rat)

Published date: 2020-12-18 22:54:27

Parathyroid hormone (1-34) (rat) Structure
Share to Facebook Share to Twitter Share to Linkedin
Name pTH (1-34) (rat) CAS# 98614-76-7
Price $Inquiry/250mg $Inquiry/100mg $Inquiry/1g Purity 98.0%
Stocking
Period
3 Day Stock 3
Product Webpage: https://www.dcchemicals.com/product_show-Parathyroid_hormone_1-34_rat.html
 Detail Product Information
Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist, increasing serum PTH levels and bone mass in rats.

Supplier/Manufacture

DC Chemicals Limited verified supplier

Chemsrc Level: Verified
Product #: 34961
Tel: 58447131
Address: Jinyu Rd100, pudong
Area: China
Contact: Tony Cao
Contact Phone #: 13564518121
Email: sales@dcchemicals.com
Website: http://www.dcchemicals.com
Major Market:
Foreign Trade % of Sales:
Major partners:
D&C Chemicals provides a wide range of research chemicals and biochemicals including novel life-science reagents, reference compounds, APIs and Natural compounds for laboratory and scientific use.



D&C Chem has established a global network of thousands of customers from many research centers and Reagent companies in the USA, Europe and Japan.

We are the the official vendor of more than 500 universities and institutes including: Harvard University,Yale University,NIH/NCI, City of Hope ORG, PARTNERS ORG,John Hopkins University,Universit tsklinikum,Oxford University,Newcastle University,UNC,UCSF and many other universities and institutes. Our bioactive compounds received good feedback from our customers.





Our credo is committed to the adoption of different products, reliable quality, competitive prices and quality service to create value for customers.
Top Suppliers:




Get all suppliers by the below link:

pTH (1-34) (rat) suppliers

Price from the other suppliers:
2024-07-15 Parathyroid Hormone Fragment 1-34 rat >=97% (HPLC), powder
Price: Inquiry
2018-01-31 AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
Price: $Inquiry
2020-04-03 pTH (1-34) (rat)
Price: ¥Inquiry
2024-05-30 pTH (1-34) (rat)
Price: $Inquiry

Get all price from the following link:

pTH (1-34) (rat)price