H-SER-ARG-THR-HIS-ARG-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2

Published date: 2021-07-26 18:31:29

H-SER-ARG-THR-HIS-ARG-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Prolactin-Releasing Peptide (12-31) (human) CAS# 235433-36-0
Price $Inquiry/100g $Inquiry/1kg $Inquiry/100kg $Inquiry/1000kg Purity 98.0%
Stocking
Period
Inquiry Stock Inquiry
 Detail Product Information
Chemical & Physical Properties:
CAS Number: 235433-36-0
Name: Prolactin-Releasing Peptide (12-31) (human)
Molecular Formula: C104H158N32O26
Molecular Weight: 2272.566
Density: 1.5±0.1 g/cm3
Boiling Point: N/A
Melting Point: N/A
Flash Point: N/A

Supplier/Manufacture

Dayang Chem (Hangzhou) Co., Ltd. verified supplier

Chemsrc Level: Verified
Product #: 48306
Tel: +86571-88938639
Address: 9/F ,Unit 2,259# Wensan Road,Xihu District, Hangzhou zhejiang, China
Area: China
Contact: Ms Wang
Contact Phone #: +86-571-8893-8639
Email: enquiry@dycnchem.com
Website: http://www.dycnchem.com
Major Market: Mainly in Southeast Asia and European and American markets
Annual Trade Volume: 10 to 20 million USD
Foreign Trade % of Sales: 90%
Major partners:
Dayang Chem (Hangzhou) Co., Ltd., (which predecessor is Hangzhou Dayangchem Co., Ltd, established in 2000),which headquartered in Hangzhou, China, is a high-tech enterprise specialized in technical research, production, development and trade of chemical products. After the recombination with Hangzhou Dayangchem Co., Ltd in 2020, Dayang chem (Hangzhou) Co., Ltd retained the whole sales, technical and after-sales team of Hangzhou Dayangchem Co., Ltd, which will serve our customers better.

DAYANG CHEM covers whole range from small amount (gram grade) for research to big bulk for industrial production. Synthesis capacity from 1 liter to 3000 liter is available.
business serve local customers and markets around the globe
Dayangchem focus on:
-Organic compounds
-Active Pharmaceutical Ingredient(s)
-Nutritional products
-Custom synthesis
-Contract Manufacturing
Top Suppliers:


Get all suppliers by the below link:

Prolactin-Releasing Peptide (12-31) (human) suppliers


Price: ¥1800/500 μg
Price from the other suppliers:
2024-07-15 Prolactin-releasingPeptidehuman
Price: Inquiry
2018-01-27 SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
Price: $Inquiry
2024-05-30 Prolactin-Releasing Peptide (12-31) (human)
Price: $Inquiry

Get all price from the following link:

Prolactin-Releasing Peptide (12-31) (human)price