Amyloid β-Protein (1-42) (mouse, rat)

Published date: 2022-03-04 07:29:33

Amyloid β-Protein (1-42) (mouse, rat) Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Amyloid β-Protein (1-42) (mouse, rat) CAS# 166090-74-0
Price ¥1999.9/1mg ¥7799.9/5mg ¥Inquiry/1g ¥Inquiry/1g Purity 98.0%
Stocking
Period
1 Day Stock In Stock
Product Webpage: http://www.aladdin-e.com/zh_cn/A275149.html
 Detail Product Information
Chemical & Physical Properties:
CAS Number: 166090-74-0
Name: Amyloid β-Protein (1-42) (mouse, rat)
Molecular Formula: C199H307N53O59S
Molecular Weight: 4418.017
Density: N/A
Boiling Point: N/A
Melting Point: N/A
Flash Point: N/A

Supplier/Manufacture

Shanghai Aladdin Biochemical Technology Co., LTD verified supplier

Chemsrc Level: Verified
Product #: 165907
Tel: 400-6206333-1
Address: 16 / F, Fortune Center, No. 36, Xinjinqiao Road, Shanghai
Area: China
Contact: Aladdin
Contact Phone #: 400-620-6333
Email: li.zg@aladdin-e.com
Website: https://www.aladdin-e.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Aladdin (stock code: 688179, listed on the Sci-Tech Innovation Board) is a leading supplier and manufacturer in the scientific research service sector, with its renowned brand "Aladdin" in the scientific service industry. Its core business spans four key areas: high-end chemical and biochemical reagents, life sciences, small molecules and compound libraries, and materials science. The company also owns the independent laboratory consumables brand "Xingui Valley" and operates primarily through e-commerce platforms. Its products are widely used by 985/211 universities, research institutes, and over 220 A-share listed companies in fields such as biomedicine and chemical materials.
In China, the company has established a modern industrial cluster covering more than 76,000 square meters, with the Shanghai Chemical Park and Fengxian Base as its core facilities. It includes GMP-certified workshops to meet diverse high-quality demands and is supported by five major logistics centers across the country. With R&D investments exceeding 300 million yuan, Aladdin operates two R&D centers focused on chemistry and biology, launching over 10,000 new products annually. As of October 2025, the company holds 178 intellectual property rights, and its products have been cited in more than 253,000 SCI papers, consistently ranking among the top three in China for scientific research reagent literature citations.
With a global strategy, Aladdin has established five subsidiaries in countries such as the United States and Germany. The company has been repeatedly recognized as a National Specialized, Sophisticated, and Innovative "Little Giant" Enterprise, ranked among China’s Top Ten Chemical Reagent Enterprises, and awarded the title of Most Popular Reagent Brand Among Customers. Upholding the mission of "Advancing Discovery, Advancing Science," Aladdin is committed to driving scientific research and innovation.
Top Suppliers:

Get all suppliers by the below link:

Amyloid β-Protein (1-42) (mouse, rat) suppliers


Price: $200/500ug
Price from the other suppliers:
2024-07-15 H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Price: Inquiry

Get all price from the following link:

Amyloid β-Protein (1-42) (mouse, rat)price