H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

Published date: 2024-07-15 12:32:44

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Amyloid β-Protein (1-42) (mouse, rat) CAS# 166090-74-0
Price Purity 95.0%
Stocking
Period
10 Day Stock In Stock
 Detail Product Information
Chemical & Physical Properties:
CAS Number: 166090-74-0
Name: Amyloid β-Protein (1-42) (mouse, rat)
Molecular Formula: C199H307N53O59S
Molecular Weight: 4418.017
Density: N/A
Boiling Point: N/A
Melting Point: N/A
Flash Point: N/A

Supplier/Manufacture

Shanghai ChemSrc Trading Co., Ltd. verified supplier

Chemsrc Level: Verified
Product #: 396716
Tel: 53555033
Address: Block b, Saint Noah Building, No. 1759, Jinshajiang Road, Putuo District, Shanghai
Area: China
Contact: Xu Qianming
Contact Phone #: 13311869306
Email: xuqm@chemsrc.com
Website: http://www.chemsrc.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Huayuan Network was officially founded in 2015 as a professional community e-commerce platform dedicated to serving the global fine chemical and biopharmaceutical R&D sectors.
With products directly supplied by strictly selected premium brand merchants, the platform takes genuine goods at favorable prices as its core advantage. Combined with a concise and user-friendly mall interface, it provides R&D professionals with one-stop procurement solutions and ensures an efficient and convenient service experience throughout the entire process.