GastrinReleasingPeptidehuman

Published date: 2024-07-15 12:37:49

GastrinReleasingPeptidehuman Structure
Share to Facebook Share to Twitter Share to Linkedin
Name GRP (human) CAS# 93755-85-2
Price Purity 98.0%
Stocking
Period
10 Day Stock In Stock
 Detail Product Information
Chemical & Physical Properties:
CAS Number: 93755-85-2
Name: GRP (human)
Molecular Formula: C130H204N38O31S2
Molecular Weight: 2859.377
Density: 1.5±0.1 g/cm3
Boiling Point: N/A
Melting Point: N/A
Flash Point: N/A

Supplier/Manufacture

Shanghai ChemSrc Trading Co., Ltd. verified supplier

Chemsrc Level: Verified
Product #: 396716
Tel: 53555033
Address: Block b, Saint Noah Building, No. 1759, Jinshajiang Road, Putuo District, Shanghai
Area: China
Contact: Xu Qianming
Contact Phone #: 13311869306
Email: xuqm@chemsrc.com
Website: http://www.chemsrc.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Huayuan Network was officially founded in 2015 as a professional community e-commerce platform dedicated to serving the global fine chemical and biopharmaceutical R&D sectors.
With products directly supplied by strictly selected premium brand merchants, the platform takes genuine goods at favorable prices as its core advantage. Combined with a concise and user-friendly mall interface, it provides R&D professionals with one-stop procurement solutions and ensures an efficient and convenient service experience throughout the entire process.
Top Suppliers:


Get all suppliers by the below link:

GRP (human) suppliers


Price: $132/500ug
Price from the other suppliers:
2024-07-15 GastrinReleasingPeptidehuman
Price: Inquiry
2018-02-02 VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Price: $Inquiry
2024-05-30 GRP (human)
Price: $Inquiry
2020-10-28 Gastrin-Releasing Peptide, human
Price: ¥Inquiry
2021-02-06 GRP (human)
Price: ¥1789.0

Get all price from the following link:

GRP (human)price