114547-31-8

114547-31-8 structure
114547-31-8 structure
  • Name: Galanin (mouse, rat)
  • Chemical Name: Galanin (1-29) (rat, mouse)
  • CAS Number: 114547-31-8
  • Molecular Formula: C141H211N43O41
  • Molecular Weight: 3164.45000
  • Catalog: Signaling Pathways GPCR/G Protein Neuropeptide Y Receptor
  • Create Date: 2018-12-25 18:41:58
  • Modify Date: 2025-08-23 18:23:44
  • Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2].

Name Galanin (1-29) (rat, mouse)
Synonyms GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2
Rat galanin
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
GALANIN,RAT
Molecular Formula C141H211N43O41
Molecular Weight 3164.45000
Exact Mass 3162.57000
PSA 1347.03000
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport
WGK Germany 3
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.