Galanin (mouse, rat)

Modify Date: 2024-01-02 11:05:36

Galanin (mouse, rat) structure	Common Name	Galanin (mouse, rat)
	CAS Number	114547-31-8	Molecular Weight	3164.45000
	Density	N/A	Boiling Point	N/A
	Molecular Formula	C₁₄₁H₂₁₁N₄₃O₄₁	Melting Point	N/A
	MSDS	Chinese USA	Flash Point	N/A

Use of Galanin (mouse, rat)

Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2].

Name	Galanin (1-29) (rat, mouse)
Synonym	More Synonyms

Description	Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2].
Related Catalog	Research Areas >> Neurological Disease Signaling Pathways >> GPCR/G Protein >> Neuropeptide Y Receptor
References	[1]. Wang S, et al. Cloning and expressional characterization of a novel galanin receptor. Identification of different pharmacophores within galanin for the three galanin receptor subtypes. J Biol Chem. 1997;272(51):31949-31952. [2]. Mazarati A, et al. Regulation of kindling epileptogenesis by hippocampal galanin type 1 and type 2 receptors: The effects of subtype-selective agonists and the role of G-protein-mediated signaling. J Pharmacol Exp Ther. 2006;318(2):700-708.

Description

Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2].

Related Catalog

Research Areas >> Neurological Disease

Signaling Pathways >> GPCR/G Protein >> Neuropeptide Y Receptor

References

[1]. Wang S, et al. Cloning and expressional characterization of a novel galanin receptor. Identification of different pharmacophores within galanin for the three galanin receptor subtypes. J Biol Chem. 1997;272(51):31949-31952.

[2]. Mazarati A, et al. Regulation of kindling epileptogenesis by hippocampal galanin type 1 and type 2 receptors: The effects of subtype-selective agonists and the role of G-protein-mediated signaling. J Pharmacol Exp Ther. 2006;318(2):700-708.

Molecular Formula	C₁₄₁H₂₁₁N₄₃O₄₁
Molecular Weight	3164.45000
Exact Mass	3162.57000
PSA	1347.03000

Personal Protective Equipment	Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR	NONH for all modes of transport
WGK Germany	3

Galanin is a paracrine inhibitor of gonadotroph function in the female rat.

Endocrinology 39 , 4222-4229, (1998)

Recent evidence suggests that pituitary galanin synthesized in the lactotroph is a paracrine regulator of lactotroph proliferation and PRL secretion and that these effects are mediated via a pituitary...

The GalR2 galanin receptor mediates galanin-induced jejunal contraction, but not feeding behavior, in the rat: differentiation of central and peripheral effects of receptor subtype activation.

FEBS Lett. 434 , 277-82, (1998)

The neuropeptide galanin mediates a diverse array of physiological functions through activation of specific receptors. Roles of the three recently cloned galanin receptors (GalRs) in rat intestinal co...

Pharmacological characterization of the contractile effects of galanin (1-29)-NH2, galantide and galanin (1-14)-(alpha-aminobutyric acid8)scyliorhinin-I in the rat gastric fundus.

Fundam. Clin. Pharmacol. 11 , 576, (1997)

Porcine galanin (1-29)-NH2, galantide (M15) and galanin (1-14)-(alpha-aminobutyric acid8)-scyliorhinin-I used in concentrations of 300, 1,000 and 3,000 nM respectively caused contractions of rat fundu...

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2

Rat galanin

H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

GALANIN,RAT