Top Suppliers:I want be here

277302-47-3

277302-47-3 structure
277302-47-3 structure
  • Name: TIP-39 trifluoroacetate salt
  • Chemical Name: TIP 39
  • CAS Number: 277302-47-3
  • Molecular Formula: C202H325N61O54S
  • Molecular Weight:
  • Catalog: Signaling Pathways GPCR/G Protein Adenylate Cyclase
  • Create Date: 2018-05-23 08:00:00
  • Modify Date: 2025-08-20 20:51:01
  • TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1].

Name TIP 39
Synonyms SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Description TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1].
Related Catalog
References

[1]. Della Penna K, et al. Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor. Neuropharmacology. 2003 Jan;44(1):141-53.

Molecular Formula C202H325N61O54S
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.