| Name | TIP 39 |
|---|---|
| Synonyms | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Description | TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1]. |
|---|---|
| Related Catalog | |
| References |
| Molecular Formula | C202H325N61O54S |
|---|---|
| Molecular Weight | 4504 |
| Exact Mass | 4503.4348199 |