Top Suppliers:I want be here

99287-08-8

99287-08-8 structure
99287-08-8 structure
  • Name: Defensin HNP-1 human
  • Chemical Name: Defensin NP 1 (human reduced)
  • CAS Number: 99287-08-8
  • Molecular Formula: C150H228N44O38S6
  • Molecular Weight: 3442.030
  • Create Date: 2018-07-12 15:02:54
  • Modify Date: 2025-08-25 11:48:38
  • Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis.

Name Defensin NP 1 (human reduced)
Synonyms HNP-1, Defensin Human Neutrophil Peptide-1
ACYCRIPACIAGERRYGTCIYQGRLWAFCC(Disulfidebridge:2-30,4-19,9-29)
Description Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis.
Target

Human Endogenous Metabolite

Density 1.5±0.1 g/cm3
Molecular Formula C150H228N44O38S6
Molecular Weight 3442.030
Exact Mass 3439.511475
LogP -8.95
Index of Refraction 1.703
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.