99287-08-8
99287-08-8 structure
- Name: Defensin HNP-1 human
- Chemical Name: Defensin NP 1 (human reduced)
- CAS Number: 99287-08-8
- Molecular Formula: C150H228N44O38S6
- Molecular Weight: 3442.030
- Create Date: 2018-07-12 15:02:54
- Modify Date: 2025-08-25 11:48:38
-
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis.
| Name | Defensin NP 1 (human reduced) |
|---|---|
| Synonyms |
HNP-1, Defensin Human Neutrophil Peptide-1
ACYCRIPACIAGERRYGTCIYQGRLWAFCC(Disulfidebridge:2-30,4-19,9-29) |
| Description | Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis. |
|---|---|
| Target |
Human Endogenous Metabolite |
| Density | 1.5±0.1 g/cm3 |
|---|---|
| Molecular Formula | C150H228N44O38S6 |
| Molecular Weight | 3442.030 |
| Exact Mass | 3439.511475 |
| LogP | -8.95 |
| Index of Refraction | 1.703 |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| RIDADR | NONH for all modes of transport |