Defensin HNP-1 human

Modify Date: 2025-08-25 11:48:38

Defensin HNP-1 human Structure
Defensin HNP-1 human structure
Common Name Defensin HNP-1 human
CAS Number 99287-08-8 Molecular Weight 3442.030
Density 1.5±0.1 g/cm3 Boiling Point N/A
Molecular Formula C150H228N44O38S6 Melting Point N/A
MSDS USA Flash Point N/A

 Use of Defensin HNP-1 human


Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis.

 Names

Name Defensin NP 1 (human reduced)
Synonym More Synonyms

 Defensin HNP-1 human Biological Activity

Description Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis.
Target

Human Endogenous Metabolite

 Chemical & Physical Properties

Density 1.5±0.1 g/cm3
Molecular Formula C150H228N44O38S6
Molecular Weight 3442.030
Exact Mass 3439.511475
LogP -8.95
Index of Refraction 1.703
InChIKey KRJOFJHOZZPBKI-UHFFFAOYSA-N
SMILES CCC(C)C1NC(=O)C2CSSCC3NC(=O)C(Cc4ccccc4)NC(=O)C(C)NC(=O)C(Cc4c[nH]c5ccccc45)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)CNC(=O)C(CCC(N)=O)NC(=O)C(Cc4ccc(O)cc4)NC(=O)C(C(C)CC)NC(=O)C(CSSCC(NC(=O)C(Cc4ccc(O)cc4)NC(=O)C(NC(=O)C(C)N)CSSCC(C(=O)O)NC3=O)C(=O)NC(CCCNC(=N)N)C(=O)NC(C(C)CC)C(=O)N3CCCC3C(=O)NC(C)C(=O)N2)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(Cc2ccc(O)cc2)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCC(=O)O)NC(=O)CNC(=O)C(C)NC1=O

 Safety Information

Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport

 Articles6

More Articles
Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37.

Infect. Immun. 83 , 4701-9, (2015)

Chlamydia trachomatis infection in the lower genital tract can ascend to and cause pathologies in the upper genital tract, potentially leading to severe complications, such as tubal infertility. Howev...

The antimicrobial peptide LL-37 facilitates the formation of neutrophil extracellular traps.

Biochem. J. 464(1) , 3-11, (2014)

NETs (neutrophil extracellular traps) have been described as a fundamental innate immune defence mechanism. During formation of NETs, the nuclear membrane is disrupted by an as-yet unknown mechanism. ...

Neutrophil serine proteinases and defensins in chronic obstructive pulmonary disease: effects on pulmonary epithelium.

Eur. Respir. J. 12 , 1200-1208, (1998)

Neutrophils have the capacity to accumulate in high numbers in the lung during infection and inflammation. Because they play an important role in host defence against infection, but may also cause tis...

 Synonyms

HNP-1, Defensin Human Neutrophil Peptide-1
ACYCRIPACIAGERRYGTCIYQGRLWAFCC(Disulfidebridge:2-30,4-19,9-29)
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
Top Suppliers:I want be here



Get all suppliers and price by the below link:

Defensin HNP-1 human suppliers

Defensin HNP-1 human price