68563-24-6

68563-24-6 structure

Name: ACTH (7-38) (human)
Chemical Name: ACTH (7-38) (human)
CAS Number: 68563-24-6
Molecular Formula: C₁₆₇H₂₅₇N₄₇O₄₆
Molecular Weight: 3659.11
Catalog: Research Areas Metabolic Disease
Create Date: 2018-02-04 16:02:32
Modify Date: 2025-08-21 20:08:20
ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1].

Name	ACTH (7-38) (human)
Synonyms	Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE

Description	ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1].
Related Catalog	Research Areas >> Metabolic Disease Signaling Pathways >> GPCR/G Protein >> Melanocortin Receptor
References	[1]. Verma PS, et.al. Inhibition of canine lung angiotensin converting enzyme by ACTH and structurally related peptides. Biochem Biophys Res Commun. 1982 Feb 26;104(4):1484-8.

Molecular Formula	C₁₆₇H₂₅₇N₄₇O₄₆
Molecular Weight	3659.11

Personal Protective Equipment	Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR	NONH for all modes of transport