Top Suppliers:I want be here

68563-24-6

68563-24-6 structure
68563-24-6 structure
  • Name: ACTH (7-38) (human)
  • Chemical Name: ACTH (7-38) (human)
  • CAS Number: 68563-24-6
  • Molecular Formula: C167H257N47O46
  • Molecular Weight: 3659.11
  • Catalog: Research Areas Metabolic Disease
  • Create Date: 2018-02-04 16:02:32
  • Modify Date: 2025-08-21 20:08:20
  • ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1].

Name ACTH (7-38) (human)
Synonyms Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Description ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1].
Related Catalog
References

[1]. Verma PS, et.al. Inhibition of canine lung angiotensin converting enzyme by ACTH and structurally related peptides. Biochem Biophys Res Commun. 1982 Feb 26;104(4):1484-8.  

Molecular Formula C167H257N47O46
Molecular Weight 3659.11
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.