68563-24-6

68563-24-6 structure
68563-24-6 structure
  • Name: ACTH (7-38) (human)
  • Chemical Name: ACTH (7-38) (human)
  • CAS Number: 68563-24-6
  • Molecular Formula: C167H257N47O46
  • Molecular Weight: 3659.11
  • Catalog: Research Areas Metabolic Disease
  • Create Date: 2018-02-04 16:02:32
  • Modify Date: 2024-01-02 13:36:50
  • ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1].

Name ACTH (7-38) (human)
Synonyms Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Description ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1].
Related Catalog
References

[1]. Verma PS, et.al. Inhibition of canine lung angiotensin converting enzyme by ACTH and structurally related peptides. Biochem Biophys Res Commun. 1982 Feb 26;104(4):1484-8.  

Molecular Formula C167H257N47O46
Molecular Weight 3659.11
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport