68563-24-6
68563-24-6 structure
- Name: ACTH (7-38) (human)
- Chemical Name: ACTH (7-38) (human)
- CAS Number: 68563-24-6
- Molecular Formula: C167H257N47O46
- Molecular Weight: 3659.11
- Catalog: Research Areas Metabolic Disease
- Create Date: 2018-02-04 16:02:32
- Modify Date: 2024-01-02 13:36:50
-
ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1].
| Name | ACTH (7-38) (human) |
|---|---|
| Synonyms |
Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE |
| Description | ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1]. |
|---|---|
| Related Catalog | |
| References |
| Molecular Formula | C167H257N47O46 |
|---|---|
| Molecular Weight | 3659.11 |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| RIDADR | NONH for all modes of transport |