Top Suppliers:I want be here




  • Taiwan Oyi peptide Co. Ltd
  • China
  • Product Name:
  • Price: $Inquiry/1mg $Inquiry/100kg
  • Purity: 98.0%
  • Stocking Period: 1 Day
  • Contact: Vinnie skype

923950-08-7

923950-08-7 structure
923950-08-7 structure
  • Name: Dulaglutide
  • Chemical Name: Dulaglutide
  • CAS Number: 923950-08-7
  • Molecular Formula: C149H221N37O49
  • Molecular Weight: 3314.62
  • Catalog: Peptides
  • Create Date: 2018-02-04 15:39:36
  • Modify Date: 2024-01-03 21:47:05
  • Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.

Name Dulaglutide
Synonyms Imidazo[1,2-a]pyridin-3-amine, N-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-(2-furanyl)-
N-(2,3-Dihydro-1,4-benzodioxin-6-yl)-2-(2-furyl)imidazo[1,2-a]pyridin-3-amine
Description Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
Related Catalog
Target

GLP-1 receptor[1]

In Vivo Dulaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist. No specific Dulaglutide-related cause of death is identified. Survival is numerically increased for both genders of animals in all Dulaglutide treatment groups and reaches statistical significance (P≤0.05) in the 0.5- and 5-mg/kg males and in the 0.05-, 0.5-, and 1.5-mg/kg females. Mean times to peak plasma concentration values of Dulaglutide are observed at 12 hours after dosing on day 1 and rang between 12 and 48 hours at week 52. The incidence of thyroid C-cell adenoma is significantly (P≤0.05) increased compare with controls in males and females at the Dulaglutide 0.5-, 1.5-, and 5-mg/kg doses[1].
Animal Admin The tumorigenic potential of Dulaglutide is evaluated in rats and transgenic mice. Rats are injected sc twice weekly for 93 weeks with Dulaglutide 0, 0.05, 0.5, 1.5, or 5 mg/kg corresponding to 0, 0.5, 7, 20, and 58 times, respectively. Transgenic mice are dosed sc twice weekly with Dulaglutide 0, 0.3, 1, or 3 mg/kg for 26 weeks[1].
References

[1]. Byrd RA, et al. Chronic Toxicity and Carcinogenicity Studies of the Long-Acting GLP-1 Receptor AgonistDulaglutide in Rodents. Endocrinology. 2015 Jul;156(7):2417-28.

Density 1.4±0.1 g/cm3
Molecular Formula C149H221N37O49
Molecular Weight 3314.62
LogP 3.81
Index of Refraction 1.706
Storage condition -20°C