475221-20-6

475221-20-6 structure
475221-20-6 structure
  • Name: Nogo-66(1-40)
  • Chemical Name: Nogo-66 (1-40)
  • CAS Number: 475221-20-6
  • Molecular Formula: C118H177N35O29S
  • Molecular Weight: 4625.11000
  • Catalog: Research Areas Inflammation/Immunology
  • Create Date: 2016-03-12 21:37:47
  • Modify Date: 2025-11-26 12:39:20
  • NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1].

Name Nogo-66 (1-40)
Synonyms m.w. 4625.11 c206h324n56o65
nogo extracellular peptide,1-40
arg-ile-tyr-lys-gly-val-ile-gln-ala-ile-gln-lys-ser-asp-glu-gly-his-pro-phe-arg-ala-tyr-leu-glu-ser-glu-val-ala-ile-ser-glu-glu-leu-val-gln-lys-tyr-ser-asn-ser-nh2
nep1-40
ac-riykgviqaiqksdeghpfraylesevaiseelvqkysns-nh2
Description NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1].
Related Catalog
In Vivo NEP(1-40) (89 μg/kg, ip, 15 min and 19 h post-injury) administration further shifts distributions of microglia away from an injury-induced activated morphology towards greater proportions of rod and macrophage-like morphologies[1]. Animal Model: 74 male Sprague-Dawley rats (328-377 g)[1]. Dosage: 89 μg/kg (97.5% PBS and 2.5% DMSO). Administration: IP, 15 min and 19 h post-injury. Result: Reduced NgR function immediately post-injury. Increased number of amoeboid microglia/macrophages at 2 days post-injury
References

[1]. Jenna M Ziebell, et al. Nogo Presence Is Inversely Associated With Shifts in Cortical Microglial Morphology Following Experimental Diffuse Brain Injury. Neuroscience. 2017 Sep 17;359:209-223.

Molecular Formula C118H177N35O29S
Molecular Weight 4625.11000
Exact Mass 4622.38000
PSA 1986.84000
LogP 3.52320
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.