Name | Nogo-66 (1-40) |
---|---|
Synonyms |
m.w. 4625.11 c206h324n56o65
nogo extracellular peptide,1-40 arg-ile-tyr-lys-gly-val-ile-gln-ala-ile-gln-lys-ser-asp-glu-gly-his-pro-phe-arg-ala-tyr-leu-glu-ser-glu-val-ala-ile-ser-glu-glu-leu-val-gln-lys-tyr-ser-asn-ser-nh2 nep1-40 ac-riykgviqaiqksdeghpfraylesevaiseelvqkysns-nh2 |
Description | NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1]. |
---|---|
Related Catalog | |
In Vivo | NEP(1-40) (89 μg/kg, ip, 15 min and 19 h post-injury) administration further shifts distributions of microglia away from an injury-induced activated morphology towards greater proportions of rod and macrophage-like morphologies[1]. Animal Model: 74 male Sprague-Dawley rats (328-377 g)[1]. Dosage: 89 μg/kg (97.5% PBS and 2.5% DMSO). Administration: IP, 15 min and 19 h post-injury. Result: Reduced NgR function immediately post-injury. Increased number of amoeboid microglia/macrophages at 2 days post-injury |
References |
Molecular Formula | C118H177N35O29S |
---|---|
Molecular Weight | 4625.11000 |
Exact Mass | 4622.38000 |
PSA | 1986.84000 |
LogP | 3.52320 |