pTH (1-38) (human)
Modify Date: 2024-07-22 13:39:04
pTH (1-38) (human) structure
|
Common Name | pTH (1-38) (human) | ||
|---|---|---|---|---|
| CAS Number | 104218-12-4 | Molecular Weight | N/A | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | N/A | Melting Point | N/A | |
| MSDS | N/A | Flash Point | N/A | |
| Name | pTH (1-38) (human) |
|---|---|
| Synonym | More Synonyms |
| No Any Chemical & Physical Properties |
| SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-VAL-ALA-LEU-GLY-ALA-PRO-LEU-ALA-PRO-ARG: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR |
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: pTH (1-38) (human)
- Price: $Inquiry/1g
- Purity: 98.0%
- Delivery: Inquiry
- Contact: Jackie Yang
- Email: ymbetter@glbiochem.com
- Nanjing Peptide Biotech Ltd
- China
- Product Name: pTH (1-38) (human)
- Price: ￥Inquiry/10g ￥Inquiry/100g ￥Inquiry/1kg ￥Inquiry/10kg
- Purity: 98.0%
- Delivery: 7 Day
- Contact: jom
- Email: chenglong.fan@njpeptide.com
- Taiwan Oyi peptide Co. Ltd
- China
- Product Name: pTH (1-38) (human)
- Price: $Inquiry/1mg $Inquiry/100kg
- Purity: 98.0%
- Delivery: 1 Day
- Contact: Vinnie
- Email: Jamie@api-made.com
Get all suppliers and price by the below link: