(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)

Modify Date: 2024-01-02 22:25:40

(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) structure	Common Name	(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)
	CAS Number	110084-95-2	Molecular Weight	3358.650
	Density	1.5±0.1 g/cm3	Boiling Point	N/A
	Molecular Formula	C₁₄₈H₂₂₁N₄₁O₄₇S	Melting Point	N/A
	MSDS	USA	Flash Point	N/A

Use of (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)

[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes[1].

Name	Des-His 1-[Glu9]Glucagon Amide
Synonym	More Synonyms

Description	[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes[1].
Related Catalog	Research Areas >> Metabolic Disease Signaling Pathways >> GPCR/G Protein >> Glucagon Receptor
Target	glucagon receptor[1]
References	[1]. Unson CG, et, al. Biological activities of des-His1[Glu9]glucagon amide, a glucagon antagonist. Peptides. 1989 Nov; 10(6): 1171-7.

Density	1.5±0.1 g/cm3
Molecular Formula	C₁₄₈H₂₂₁N₄₁O₄₇S
Molecular Weight	3358.650
Exact Mass	3356.588379
PSA	1512.05000
LogP	-6.53
Index of Refraction	1.676

Personal Protective Equipment	Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR	NONH for all modes of transport
WGK Germany	3

Glucagon stimulates exocytosis in mouse and rat pancreatic alpha-cells by binding to glucagon receptors.

Mol. Endocrinol. 19 , 198-212, (2005)

Glucagon, secreted by the pancreatic alpha-cells, stimulates insulin secretion from neighboring beta-cells by cAMP- and protein kinase A (PKA)-dependent mechanisms, but it is not known whether glucago...

Glucagon receptors on human islet cells contribute to glucose competence of insulin release.

Diabetologia 43 , 1012-1019, (2000)

Synergism between glucose and cAMP in the stimulation of insulin secretion has been suggested to regulate beta cells. This study assessed the importance of an interaction between glucose and cAMP in t...

Biological activities of des-His1[Glu9]glucagon amide, a glucagon antagonist.

Peptides 10 , 1171, (1989)

Hyperglycemia in diabetes mellitus is generally associated with elevated levels of glucagon in the blood. A glucagon analog, des-His1[Glu9]glucagon amide, has been designed and synthesized and found t...

L-Threoninamide, L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-glutamyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-α-aspartyl-L-seryl-L-arginyl-L-arginyl-L-al anyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-

L-threoninamide, L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-glutamyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-α-aspartyl-L-seryl-N-(diaminomethylene)-L-ornithyl-N-(diaminomethylene)-L-ornithyl-L-alanyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-

L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-glutamyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-α-aspartyl-L-seryl-N-(diaminomethylidene)-L-ornithyl-N-(diaminomethylidene)-L-ornithyl-L-alanyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threoninamide

L-Seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-glutamyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-α-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl -L-α-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threoninamide

MFCD00080353

SER-GLN-GLY-THR-PHE-THR-SER-GLU-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-NH2

SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2