BNP-32 (porcine) trifluoroacetate salt

Modify Date: 2025-09-01 21:01:44

BNP-32 (porcine) trifluoroacetate salt Structure
BNP-32 (porcine) trifluoroacetate salt structure
Common Name BNP-32 (porcine) trifluoroacetate salt
CAS Number 117345-87-6 Molecular Weight 3570.10000
Density N/A Boiling Point N/A
Molecular Formula C149H250N52O44S3 Melting Point N/A
MSDS N/A Flash Point N/A

 Names

Name Brain Natriuretic Peptide-32 Porcine
Synonym More Synonyms

 Chemical & Physical Properties

Molecular Formula C149H250N52O44S3
Molecular Weight 3570.10000
Exact Mass 3567.81000
PSA 1669.02000
LogP 0.11710
InChIKey REIZCGMXQDPCLB-JJUAJPTCSA-N
SMILES CCC(C)C1NC(=O)C(CCCNC(=N)N)NC(=O)C(CC(=O)O)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCCNC(=N)N)NC(=O)CNC(=O)C(Cc2ccccc2)NC(=O)C(NC(=O)CNC(=O)C(CO)NC(=O)C(CC(=O)O)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCSC)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C2CCCN2C(=O)C(N)CO)C(C)O)CSSCC(C(=O)NC(CC(N)=O)C(=O)NC(C(=O)NC(CC(C)C)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(Cc2ccc(O)cc2)C(=O)O)C(C)C)NC(=O)CNC(=O)C(CC(C)C)NC(=O)CNC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CO)NC(=O)CNC1=O

 Synonyms

SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
Top Suppliers:I want be here


Get all suppliers and price by the below link:

BNP-32 (porcine) trifluoroacetate salt suppliers

BNP-32 (porcine) trifluoroacetate salt price