117345-87-6

117345-87-6 structure
117345-87-6 structure
  • Name: BNP-32 (porcine) trifluoroacetate salt
  • Chemical Name: Brain Natriuretic Peptide-32 Porcine
  • CAS Number: 117345-87-6
  • Molecular Formula: C149H250N52O44S3
  • Molecular Weight: 3570.10000
  • Create Date: 2019-01-03 18:49:39
  • Modify Date: 2025-09-01 21:01:44

Name Brain Natriuretic Peptide-32 Porcine
Synonyms SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY
Molecular Formula C149H250N52O44S3
Molecular Weight 3570.10000
Exact Mass 3567.81000
PSA 1669.02000
LogP 0.11710
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.