Exendin-4 (3-39) structure
|
Common Name | Exendin-4 (3-39) | ||
---|---|---|---|---|
CAS Number | 196109-31-6 | Molecular Weight | N/A | |
Density | N/A | Boiling Point | N/A | |
Molecular Formula | C176H272N46O58S | Melting Point | N/A | |
MSDS | N/A | Flash Point | N/A |
Use of Exendin-4 (3-39)Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2]. |
Name | Exendin-4 (3-39) |
---|---|
Synonym | More Synonyms |
Description | Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2]. |
---|---|
Related Catalog | |
In Vivo | GLP-1 (i.p.; 5 μg/kg) increases circulating corticosterone and aldosterone levels[2]. Animal Model: Rats[2] Dosage: 5 μg/kg Administration: Intraperitoneal injections Result: Increased circulating corticosterone levels in a time-dependent manner both in conscious and anaesthetized rats and also increased aldosterone levels. |
Molecular Formula | C176H272N46O58S |
---|
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |