Exendin-4 (3-39)
Modify Date: 2024-01-02 17:14:02
Exendin-4 (3-39) structure
|
Common Name | Exendin-4 (3-39) | ||
|---|---|---|---|---|
| CAS Number | 196109-31-6 | Molecular Weight | N/A | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C176H272N46O58S | Melting Point | N/A | |
| MSDS | N/A | Flash Point | N/A | |
Use of Exendin-4 (3-39)Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2]. |
| Name | Exendin-4 (3-39) |
|---|---|
| Synonym | More Synonyms |
| Description | Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2]. |
|---|---|
| Related Catalog | |
| In Vivo | GLP-1 (i.p.; 5 μg/kg) increases circulating corticosterone and aldosterone levels[2]. Animal Model: Rats[2] Dosage: 5 μg/kg Administration: Intraperitoneal injections Result: Increased circulating corticosterone levels in a time-dependent manner both in conscious and anaesthetized rats and also increased aldosterone levels. |
| Molecular Formula | C176H272N46O58S |
|---|
| EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- Price: $Inquiry/1g
- Purity: 98.0%
- Stocking Period: Inquiry
- Contact: Jackie Yang
- Dayang Chem (Hangzhou) Co., Ltd.
- China
- Product Name: EXENDIN-4 (3-39)
- Price: $Inquiry/100g $Inquiry/1kg $Inquiry/100kg $Inquiry/1000kg
- Purity: 98.0%
- Stocking Period: Inquiry
- Contact: Ms Wang
- Zhejiang Hangyu API Co., Ltd
- China
- Product Name: Exendin-4 (3-39)
- Price: $Inquiry/1kg
- Purity: 99.0%
- Stocking Period: 1 Day
- Contact: Vinnie
Get all suppliers and price by the below link: