Top Suppliers:I want be here

196109-31-6

196109-31-6 structure
196109-31-6 structure
  • Name: Exendin-4 (3-39)
  • Chemical Name: Exendin-4 (3-39)
  • CAS Number: 196109-31-6
  • Molecular Formula: C176H272N46O58S
  • Molecular Weight:
  • Catalog: Research Areas Endocrinology
  • Create Date: 2018-05-21 08:00:00
  • Modify Date: 2025-08-20 13:19:29
  • Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2].

Name Exendin-4 (3-39)
Synonyms EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Description Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2].
Related Catalog
In Vivo GLP-1 (i.p.; 5 μg/kg) increases circulating corticosterone and aldosterone levels[2]. Animal Model: Rats[2] Dosage: 5 μg/kg Administration: Intraperitoneal injections Result: Increased circulating corticosterone levels in a time-dependent manner both in conscious and anaesthetized rats and also increased aldosterone levels.
Molecular Formula C176H272N46O58S
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.