196109-31-6

196109-31-6 structure

Name: Exendin-4 (3-39)
Chemical Name: Exendin-4 (3-39)
CAS Number: 196109-31-6
Molecular Formula: C₁₇₆H₂₇₂N₄₆O₅₈S
Molecular Weight:
Catalog: Research Areas Endocrinology
Create Date: 2018-05-21 08:00:00
Modify Date: 2024-01-02 17:14:02
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2].

Name	Exendin-4 (3-39)
Synonyms	EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Description	Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2].
Related Catalog	Research Areas >> Endocrinology Research Areas >> Neurological Disease
In Vivo	GLP-1 (i.p.; 5 μg/kg) increases circulating corticosterone and aldosterone levels[2]. Animal Model: Rats[2] Dosage: 5 μg/kg Administration: Intraperitoneal injections Result: Increased circulating corticosterone levels in a time-dependent manner both in conscious and anaesthetized rats and also increased aldosterone levels.

Molecular Formula	C₁₇₆H₂₇₂N₄₆O₅₈S