LEESGGGLVQPGGSMK
Modify Date: 2025-08-30 12:30:29
LEESGGGLVQPGGSMK structure
|
Common Name | LEESGGGLVQPGGSMK | ||
|---|---|---|---|---|
| CAS Number | 2096980-79-7 | Molecular Weight | 1545.71 | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C64H108N18O24S | Melting Point | N/A | |
| MSDS | N/A | Flash Point | N/A | |
Use of LEESGGGLVQPGGSMKLEESGGGLVQPGGSMK, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α[1]. |
| Name | LEESGGGLVQPGGSMK |
|---|
| Description | LEESGGGLVQPGGSMK, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α[1]. |
|---|---|
| Related Catalog | |
| In Vitro | The anti-TNF antibodies blocking the action of TNF alpha revolutionized therapy of TNF-related diseases such as Inflammatory Bowel Disease, lupus, ulcerative colitis, ankylosing spondylitis, psoriatic arthritis and rheumatoid arthritis. By neutralizing TNF activity, anti-TNF antibodies promote mucosal healing and induce long-term remissions in vivo. The main anti-TNF antibodies that are currently authorized encompass Infliximab, Etanercept, Adalimumab, Certolizumab and Golimumab[1]. |
| References |
[1]. Dorothée LEBERT, et al. A method for quantifying therapeutic antibodies. EP3371592A1. |
| Molecular Formula | C64H108N18O24S |
|---|---|
| Molecular Weight | 1545.71 |