GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt

Modify Date: 2025-08-22 22:27:44

GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt Structure
GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt structure
Common Name GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS Number 99658-04-5 Molecular Weight 533.688
Density 1.3±0.1 g/cm3 Boiling Point N/A
Molecular Formula C28H35N7O2S Melting Point N/A
MSDS N/A Flash Point N/A

 Use of GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt


GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1].

 Names

Name Glucagon-like Peptide 1 Amide (Human)
Synonym More Synonyms

  Biological Activity

Description GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1].
Related Catalog
References

[1]. Schmidtler J, Schepp W, Janczewska I, et al. GLP-1-(7-36) amide, -(1-37), and -(1-36) amide: potent cAMP-dependent stimuli of rat parietal cell function. Am J Physiol. 1991;260(6 Pt 1):G940-G950.  

 Chemical & Physical Properties

Density 1.3±0.1 g/cm3
Molecular Formula C28H35N7O2S
Molecular Weight 533.688
Exact Mass 533.257263
LogP 3.10
Index of Refraction 1.666
Storage condition −20°C

 Safety Information

WGK Germany 3

 Synonyms

Methanesulfonamide, N-methyl-N-[[2-[[[2-[[4-(1-methyl-4-piperidinyl)phenyl]amino][1,2,4]triazolo[1,5-a]pyridin-8-yl]amino]methyl]phenyl]methyl]-
N-Methyl-N-(2-{[(2-{[4-(1-methyl-4-piperidinyl)phenyl]amino}[1,2,4]triazolo[1,5-a]pyridin-8-yl)amino]methyl}benzyl)methanesulfonamide
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
Top Suppliers:I want be here