Gastric Inhibitory Polypeptide (human)

Suppliers

Names

[ CAS No. ]:
100040-31-1

[ Name ]:
Gastric Inhibitory Polypeptide (human)

[Synonym ]:
MFCD00081634
GIP, human
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Gastric Inhibitory Peptide (GIP), human

Chemical & Physical Properties

[ Molecular Formula ]:
C226H338N60O66S

[ Molecular Weight ]:
4983.53

[ Storage condition ]:
-20°C

Safety Information

[ Personal Protective Equipment ]:
Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter

[ Hazard Codes ]:
Xn

[ RIDADR ]:
NONH for all modes of transport

[ WGK Germany ]:
3.0

Articles

Long-term persistence of hormonal adaptations to weight loss.

N. Engl. J. Med. 365 , 1597-1604, (2011)

After weight loss, changes in the circulating levels of several peripheral hormones involved in the homeostatic regulation of body weight occur. Whether these changes are transient or persist over tim...

Pleiotropic effects of GIP on islet function involve osteopontin.

Diabetes 60 , 2424-2433, (2011)

The incretin hormone GIP (glucose-dependent insulinotropic polypeptide) promotes pancreatic β-cell function by potentiating insulin secretion and β-cell proliferation. Recently, a combined analysis of...

Gastric inhibitory polypeptide and its receptor are expressed in the central nervous system and support neuronal survival.

Cent. Nerv. Syst. Agents Med. Chem. 11 , 210-222, (2011)

The development of neuronal apoptosis depends on an intrinsic transcriptional program. By DNA microarray technology, we have previously implicated a number of genes in different paradigms of neuronal ...


More Articles


Related Compounds

  • (Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
  • (D-Ala2)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
  • Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt
  • Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
  • gastric inhibitory polypeptide (1-39)
  • Gastric Inhibitory Polypeptide (1-30), porcine
  • 3,3-Difluoro-3-(4-methoxy-2-methylphenyl)propan-1-ol
  • 3,3-Difluoro-1-[5-(4-methylphenyl)furan-2-yl]cyclobutan-1-amine
  • 1-[3-(Pentafluoroethyl)phenyl]prop-2-en-1-ol
  • 2-Chloro-1-[3-(pentafluoroethyl)phenyl]ethan-1-one
  • 2-(3-Chloro-2,4-difluorophenyl)-2-methylpropan-1-amine
  • {1-[(3-Chloro-2,4-difluorophenyl)methyl]cyclopropyl}methanamine
  • 2-Amino-3-(3,5-dichlorophenyl)-2-methylpropan-1-ol
  • Methyl 3-(3-chlorothiophen-2-yl)-3-oxopropanoate
  • 2-(3,6-Dichloropyridazin-4-yl)acetaldehyde
  • {1-[(3,6-Dichloropyridazin-4-yl)methyl]cyclopropyl}methanamine
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.