Corticotropin-Releasing Factor, human, rat

Published date: 2024-01-16 16:41:04

Corticotropin-Releasing Factor, human, rat Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Corticotropin-Releasing Factor, human, rat CAS# 86784-80-7
Price ¥3360.0/5mg ¥3850.0/10mg ¥4550.0/50mg ¥5950.0/100mg Purity 98.0%
Stocking
Period
Inquiry Stock 需询单
 Detail Product Information
Chemical & Physical Properties:
CAS Number: 86784-80-7
Name: Corticotropin-Releasing Factor, human, rat
Molecular Formula: C208H344N60O63S2
Molecular Weight: 4757.45
Density: N/A
Boiling Point: N/A
Melting Point: N/A
Flash Point: N/A

Supplier/Manufacture

Fuzhou Feijing Biological Technology Co., LTD

Chemsrc Level: Unverified
Tel: 0591-22822350
Address: 7F4, Guanpeng Park, No. 28, Xinghu Road, Nanyu Town
Area: China
Contact: Xiao Fei
Contact Phone #: 18059081430
Email: 2070812664@qq.com
Website: http://www.phygene.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Phygene is an integrated provider of life science research services and manufacturing, with products and services covering all key scientific research institutions. At present, it has 2500 square meters of research and production base, and is equipped with 100,000 aseptic working areas. It is a national high-tech enterprise and a science and technology small and medium-sized enterprise in Fujian Province. Since its establishment in 2015, it has focused on the development of efficient detection kits, polypeptide reagents, standard solutions, ready-to-use reagents and cost-effective experimental consumables, and its products have been widely involved in the scientific research fields of life science, agricultural biotechnology, pharmaceutical and industry, innovative medical treatment, petrochemical industry, and water quality testing. Our mission is to help our customers accelerate research in science, turn theoretical opportunities into productivity, and make research easier.

The company has passed ISO9001 quality management system certification, and has maintained long-term cooperative relations with many domestic and foreign universities and research institutions. The products involved are widely used by well-known universities and research institutes such as Chinese Academy of Sciences, Tsinghua University, Peking University, Fudan University, Zhejiang University, Lanzhou University, Nanjing University, Southeast University, Xiamen University, etc. Many research papers using Phygene products have been published, including publication in international high-level academic journals such as Cell, Nature, and Science.

Phygene's product line covers a variety of reagents and kits in molecular biology, cell biology, immunology, proteomics, peptide synthesis, biomedicine, standard titrations, ready-to-use reagents and other fields.
Top Suppliers:


Get all suppliers by the below link:

Corticotropin-Releasing Factor, human, rat suppliers


Price: $60/250ug
Price from the other suppliers:
2024-07-15 Corticotropin-Releasing Factor, human, rat
Price: Inquiry
2018-02-05 SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Price: $Inquiry
2019-03-05 Corticotropin-Releasing Factor, human, rat
Price: ¥Inquiry
2023-11-16 Corticotropin-Releasing Factor, human, rat
Price: ¥Inquiry
2021-02-06 CRF (human, rat)
Price: ¥1909.0

Get all price from the following link:

Corticotropin-Releasing Factor, human, ratprice