Corticotropin-Releasing Factor, human, rat

Modify Date: 2025-08-27 08:49:52

Corticotropin-Releasing Factor, human, rat structure	Common Name	Corticotropin-Releasing Factor, human, rat
	CAS Number	86784-80-7	Molecular Weight	4757.45
	Density	N/A	Boiling Point	N/A
	Molecular Formula	C₂₀₈H₃₄₄N₆₀O₆₃S₂	Melting Point	N/A
	MSDS	USA	Flash Point	N/A

Use of Corticotropin-Releasing Factor, human, rat

Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2.

Name	Corticotropin-releasing factor (human and rat)
Synonym	More Synonyms

Description	Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2.
Related Catalog	Signaling Pathways >> Others >> Others Research Areas >> Neurological Disease Peptides
In Vitro	CRF increases excitability of type II dlBNST neurons through activation of the AC-cAMP-PKA pathway, thereby causing pain-induced aversive responses[1].
In Vivo	The findings are consistent with a mechanism whereby the excess CRF that characterizes stress-related diseases initiates distinct cellular processes in male and female brains, as a result of sex-biased CRF1 signaling[2]. CRF injection on food intake (FI), CRF suppresses FI in 3-month male and female animals[3].
References	[1]. Kaneko T et al. Activation of adenylate cyclase-cyclic AMP-protein kinase A signaling by corticotropin-releasing factorwithin the dorsolateral bed nucleus of the stria terminalis is involved in pain-induced aversion. Eur J Neurosci. 2016 Sep 30. [2]. Bangasser DA et al. Corticotropin-releasing factor overexpression gives rise to sex differences in Alzheimer's disease-related signaling. Mol Psychiatry. 2016 Oct 18. [3]. Tenk J et al. Acute central effects of corticotropin-releasing factor (CRF) on energy balance: Effects of age and gender. Peptides. 2016 Nov;85:63-72.

Molecular Formula	C₂₀₈H₃₄₄N₆₀O₆₃S₂
Molecular Weight	4757.45
Storage condition	−20°C

Personal Protective Equipment	Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes	Xi
RIDADR	NONH for all modes of transport
WGK Germany	3
RTECS	GM7925000

Effects of corticotrophin releasing hormone (CRH) on cell viability and differentiation in the human BeWo choriocarcinoma cell line: a potential syncytialisation inducer distinct from cyclic adenosine monophosphate (cAMP).

Reprod. Biol. Endocrinol. 11 , 30, (2013)

Placental production of corticotrophin releasing hormone (CRH) rises exponentially as pregnancy progresses, and has been linked with the onset of normal and preterm labour. CRH is produced in syncytio...

Modulation of Sleep Homeostasis by Corticotropin Releasing Hormone in REM Sleep-Deprived Rats.

Int. J. Endocrinol. 2010 , 326151, (2010)

Studies have shown that sleep recovery following different protocols of forced waking varies according to the level of stress inherent to each method. Sleep deprivation activates the hypothalamic-pitu...

Identification of a novel interaction between corticotropin releasing hormone (Crh) and macroautophagy.

Sci. Rep. 6 , 23342, (2016)

In inflammatory bowel disease (IBD), compromised restitution of the epithelial barrier contributes to disease severity. Owing to the complexity in the pathogenesis of IBD, a variety of factors have be...

Human corticotropin-releasing hormone-41

Rat/human corticotropin-releasing factor

Corticorelin acetate

Corticorelin

Human CRF(1-41)

MFCD00213806

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Corticorelin (Human)

Corticotropin-releasing factor (human)