Top Suppliers:I want be here

86784-80-7

86784-80-7 structure
86784-80-7 structure
  • Name: Corticotropin-Releasing Factor, human, rat
  • Chemical Name: Corticotropin-releasing factor (human and rat)
  • CAS Number: 86784-80-7
  • Molecular Formula: C208H344N60O63S2
  • Molecular Weight: 4757.45
  • Catalog: Biochemical Peptide
  • Create Date: 2018-09-01 11:07:59
  • Modify Date: 2025-08-27 08:49:52
  • Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2.

Name Corticotropin-releasing factor (human and rat)
Synonyms Human corticotropin-releasing hormone-41
Rat/human corticotropin-releasing factor
Corticorelin acetate
Corticorelin
Human CRF(1-41)
MFCD00213806
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Corticorelin (Human)
Corticotropin-releasing factor (human)
Description Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2.
Related Catalog
In Vitro CRF increases excitability of type II dlBNST neurons through activation of the AC-cAMP-PKA pathway, thereby causing pain-induced aversive responses[1].
In Vivo The findings are consistent with a mechanism whereby the excess CRF that characterizes stress-related diseases initiates distinct cellular processes in male and female brains, as a result of sex-biased CRF1 signaling[2]. CRF injection on food intake (FI), CRF suppresses FI in 3-month male and female animals[3].
References

[1]. Kaneko T et al. Activation of adenylate cyclase-cyclic AMP-protein kinase A signaling by corticotropin-releasing factorwithin the dorsolateral bed nucleus of the stria terminalis is involved in pain-induced aversion. Eur J Neurosci. 2016 Sep 30.

[2]. Bangasser DA et al. Corticotropin-releasing factor overexpression gives rise to sex differences in Alzheimer's disease-related signaling. Mol Psychiatry. 2016 Oct 18.

[3]. Tenk J et al. Acute central effects of corticotropin-releasing factor (CRF) on energy balance: Effects of age and gender. Peptides. 2016 Nov;85:63-72.

Molecular Formula C208H344N60O63S2
Molecular Weight 4757.45
Storage condition −20°C
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes Xi
RIDADR NONH for all modes of transport
WGK Germany 3
RTECS GM7925000
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.