| Name | Corticotropin-releasing factor (human and rat) |
|---|---|
| Synonyms |
Human corticotropin-releasing hormone-41
Rat/human corticotropin-releasing factor Corticorelin acetate Corticorelin Human CRF(1-41) MFCD00213806 SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 Corticorelin (Human) Corticotropin-releasing factor (human) |
| Description | Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2. |
|---|---|
| Related Catalog | |
| In Vitro | CRF increases excitability of type II dlBNST neurons through activation of the AC-cAMP-PKA pathway, thereby causing pain-induced aversive responses[1]. |
| In Vivo | The findings are consistent with a mechanism whereby the excess CRF that characterizes stress-related diseases initiates distinct cellular processes in male and female brains, as a result of sex-biased CRF1 signaling[2]. CRF injection on food intake (FI), CRF suppresses FI in 3-month male and female animals[3]. |
| References |
| Molecular Formula | C208H344N60O63S2 |
|---|---|
| Molecular Weight | 4757.45 |
| Storage condition | −20°C |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| Hazard Codes | Xi |
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3 |
| RTECS | GM7925000 |