74815-57-9

74815-57-9 structure
74815-57-9 structure
  • Name: GRP (porcine)
  • Chemical Name: gastrin releasing peptide, porcine
  • CAS Number: 74815-57-9
  • Molecular Formula: C126H198N38O31S2
  • Molecular Weight: 2805.29
  • Catalog: Research Areas Cancer
  • Create Date: 2017-12-13 14:56:14
  • Modify Date: 2025-09-18 18:35:18
  • GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors[1][2].

Name gastrin releasing peptide, porcine
Synonyms APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2
Description GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors[1][2].
Related Catalog
References

[1]. McDonald TJ, et al. The effect of gastrin-releasing peptide on the endocrine pancreas. Ann N Y Acad Sci. 1988;547:242-54.  

[2]. Bostwick DG, Bensch KG. Gastrin releasing peptide in human neuroendocrine tumours. J Pathol. 1985 Dec;147(4):237-44.  

Molecular Formula C126H198N38O31S2
Molecular Weight 2805.29
Exact Mass 2803.45000
PSA 1123.58000
LogP 3.34950
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.