Top Suppliers:I want be here

9015-71-8

9015-71-8 structure
9015-71-8 structure
  • Name: Corticotropin Releasing Factor (148-188), ovine
  • Chemical Name: Corticotropin Releasing Factor sheep
  • CAS Number: 9015-71-8
  • Molecular Formula: C₂₀₅H₃₃₉N₅₉O₆₃S
  • Molecular Weight: 4670.38
  • Catalog: Research Areas Neurological Disease
  • Create Date: 2018-02-06 13:14:47
  • Modify Date: 2025-08-21 09:19:42
  • Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2].

Name Corticotropin Releasing Factor sheep
Synonyms SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Corticotropin Releasing Factor (148-188), ovine
Description Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2].
Related Catalog
Molecular Formula C₂₀₅H₃₃₉N₅₉O₆₃S
Molecular Weight 4670.38
Storage condition -20°C
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes Xi
RIDADR NONH for all modes of transport
WGK Germany 3.0
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.