9015-71-8
9015-71-8 structure
- Name: Corticotropin Releasing Factor (148-188), ovine
- Chemical Name: Corticotropin Releasing Factor sheep
- CAS Number: 9015-71-8
- Molecular Formula: C₂₀₅H₃₃₉N₅₉O₆₃S
- Molecular Weight: 4670.38
- Catalog: Research Areas Neurological Disease
- Create Date: 2018-02-06 13:14:47
- Modify Date: 2024-01-02 18:54:16
-
Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2].
| Name | Corticotropin Releasing Factor sheep |
|---|---|
| Synonyms |
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Corticotropin Releasing Factor (148-188), ovine |
| Description | Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2]. |
|---|---|
| Related Catalog |
| Molecular Formula | C₂₀₅H₃₃₉N₅₉O₆₃S |
|---|---|
| Molecular Weight | 4670.38 |
| Storage condition | -20°C |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| Hazard Codes | Xi |
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3.0 |