![]() Corticotropin Releasing Factor (148-188), ovine structure
|
Common Name | Corticotropin Releasing Factor (148-188), ovine | ||
---|---|---|---|---|
CAS Number | 9015-71-8 | Molecular Weight | 4670.38 | |
Density | N/A | Boiling Point | N/A | |
Molecular Formula | C₂₀₅H₃₃₉N₅₉O₆₃S | Melting Point | N/A | |
MSDS | USA | Flash Point | N/A |
Use of Corticotropin Releasing Factor (148-188), ovineCorticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2]. |
Name | Corticotropin Releasing Factor sheep |
---|---|
Synonym | More Synonyms |
Description | Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2]. |
---|---|
Related Catalog |
Molecular Formula | C₂₀₅H₃₃₉N₅₉O₆₃S |
---|---|
Molecular Weight | 4670.38 |
Storage condition | -20°C |
Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
---|---|
Hazard Codes | Xi |
RIDADR | NONH for all modes of transport |
WGK Germany | 3.0 |
Neurokinin B signaling in the female rat: a novel link between stress and reproduction.
Endocrinology 155(7) , 2589-601, (2014) Acute systemic stress disrupts reproductive function by inhibiting pulsatile gonadotropin secretion. The underlying mechanism involves stress-induced suppression of the GnRH pulse generator, the funct... |
|
Expression and regulation of neuromedin B in pituitary corticotrophs of male melanocortin 2 receptor-deficient mice.
Endocrinology 155(7) , 2492-9, (2014) The hypothalamic-pituitary-adrenal (HPA) axis is a major part of the neuroendocrine system that controls responses to stress, and has an important function in the regulation of various body processes.... |
|
Bisphenol A differentially activates protein kinase C isoforms in murine placental tissue
Toxicol. Appl. Pharmacol. 269(2) , 163-8, (2013) Bisphenol A is utilized to make polycarbonate plastics and is an environmental pollutant. Recent research has indicated that it is an endocrine disruptor and may interfere with reproductive processes.... |
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 |
Corticotropin Releasing Factor (148-188), ovine |