Corticotropin Releasing Factor (148-188), ovine

Modify Date: 2025-08-21 09:19:42

Corticotropin Releasing Factor (148-188), ovine Structure
Corticotropin Releasing Factor (148-188), ovine structure
Common Name Corticotropin Releasing Factor (148-188), ovine
CAS Number 9015-71-8 Molecular Weight 4670.38
Density N/A Boiling Point N/A
Molecular Formula C₂₀₅H₃₃₉N₅₉O₆₃S Melting Point N/A
MSDS USA Flash Point N/A

 Use of Corticotropin Releasing Factor (148-188), ovine


Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2].

 Names

Name Corticotropin Releasing Factor sheep
Synonym More Synonyms

  Biological Activity

Description Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2].
Related Catalog

 Chemical & Physical Properties

Molecular Formula C₂₀₅H₃₃₉N₅₉O₆₃S
Molecular Weight 4670.38
InChIKey IESDGNYHXIOKRW-YXMSTPNBSA-N
SMILES CC(O)C(N)C(=O)NC(CCCCN)C(=O)N1CCCC1C(=O)NC(CCCN=C(N)N)C(=O)O
Storage condition -20°C

 Safety Information

Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes Xi
RIDADR NONH for all modes of transport
WGK Germany 3.0

 Articles69

More Articles
Neurokinin B signaling in the female rat: a novel link between stress and reproduction.

Endocrinology 155(7) , 2589-601, (2014)

Acute systemic stress disrupts reproductive function by inhibiting pulsatile gonadotropin secretion. The underlying mechanism involves stress-induced suppression of the GnRH pulse generator, the funct...

Expression and regulation of neuromedin B in pituitary corticotrophs of male melanocortin 2 receptor-deficient mice.

Endocrinology 155(7) , 2492-9, (2014)

The hypothalamic-pituitary-adrenal (HPA) axis is a major part of the neuroendocrine system that controls responses to stress, and has an important function in the regulation of various body processes....

Bisphenol A differentially activates protein kinase C isoforms in murine placental tissue

Toxicol. Appl. Pharmacol. 269(2) , 163-8, (2013)

Bisphenol A is utilized to make polycarbonate plastics and is an environmental pollutant. Recent research has indicated that it is an endocrine disruptor and may interfere with reproductive processes....

 Synonyms

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Corticotropin Releasing Factor (148-188), ovine
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
Top Suppliers:I want be here


Get all suppliers and price by the below link:

Corticotropin Releasing Factor (148-188), ovine suppliers


Price: $190/500ug

Reference only. check more Corticotropin Releasing Factor (148-188), ovine price