- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: CART (55-102) (human)
- Price:
- Purity: 98.0%
- Stocking Period: 10 Day
- Contact: Yang
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
- Price: $Inquiry/1g
- Purity: 98.0%
- Stocking Period: Inquiry
- Contact: Jackie Yang
- DC Chemicals Limited
- China
- Product Name: CART(55-102)(human)
- Price: $Inquiry/250mg $Inquiry/100mg $Inquiry/1g
- Purity: 98.0%
- Stocking Period: 3 Day
- Contact: Tony Cao
- Taiwan Oyi peptide Co. Ltd
- China
- Product Name: CART (55-102) (human) trifluoroacetate salt
- Price: $Inquiry/1mg $Inquiry/100kg
- Purity: 98.0%
- Stocking Period: 1 Day
- Contact: Vinnie
214050-22-3
214050-22-3 structure
- Name: CART (55-102) (human) trifluoroacetate salt
- Chemical Name: CART (55-102) (huMan)
- CAS Number: 214050-22-3
- Molecular Formula: C225H365N65O65S7
- Molecular Weight:
- Catalog: Research Areas Neurological Disease
- Create Date: 2018-03-05 21:16:07
- Modify Date: 2024-01-02 10:36:47
-
CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y[1][2].
| Name | CART (55-102) (huMan) |
|---|---|
| Synonyms |
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL(Disulfidebridge:74-94,68-86,and88-101)
H-Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH |
| Description | CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y[1][2]. |
|---|---|
| Related Catalog | |
| References |
| Molecular Formula | C225H365N65O65S7 |
|---|