Top Suppliers:I want be here


122613-29-0

122613-29-0 structure
122613-29-0 structure
  • Name: Protein Kinase C (530-558)
  • Chemical Name: PKC fragment (530-558)
  • CAS Number: 122613-29-0
  • Molecular Formula: C148H221N35O50S2
  • Molecular Weight: 3354.67000
  • Catalog: Signaling Pathways Epigenetics PKC
  • Create Date: 2018-11-29 09:56:22
  • Modify Date: 2025-08-25 21:58:34
  • Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption[1].

Name PKC fragment (530-558)
Synonyms protein kinase c fragment 530-558
h-leu-leu-tyr-glu-met-leu-ala-gly-gln-ala-pro-phe-glu-gly-glu-asp-glu-asp-glu-leu-phe-gln-ser-ile-met-glu-his-asn-val-nh2
llyemlagqapfegededelfqsimehnv-nh2
llyemlagqapfegededelfqsimehnv
Protein Kinase C (530-558)
LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2
Description Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption[1].
Related Catalog
In Vitro Protein Kinase C (530-558) (1 nM-1 μM, 24 h) causes a dose-responsive inhibition of bone resorption, which is accompanied by a rapid and distinctive change in osteoclast morphology[1]. Cell Viability Assay[1] Cell Line: Osteoclast cell Concentration: 1 nM, 10 nM, 100 nM, 1 μM Incubation Time: 24 h Result: Showed a dose-responsive, marked inhibition of bone resorption was observed between 10 nM and 1 μM. At 1 μM, resorption was inhibited by more thaln 87 %.
Density 1.4±0.1g/cm3
Boiling Point 3001.7±65.0°C at 760 mmHg
Molecular Formula C148H221N35O50S2
Molecular Weight 3354.67000
Flash Point 1769.2±34.3°C
Exact Mass 3352.53000
PSA 1422.53000
LogP 3.50500
Index of Refraction 1.582
WGK Germany 3
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.