Shanghai Nianxing Industrial Co., Ltd
China
Product Name: Palmitic acid
Price: Check
Purity: 98.0%
Stocking Period: 10 Day
Contact: Yang
Email: sales@echemcloud.com

Henan Tianfu Chemical Co., Ltd.
China
Product Name: Glucagon
Price: $Inquiry/1kg $Inquiry/25kg $Inquiry/1000kg $Inquiry/10ton
Purity: 99.0%
Stocking Period: Inquiry
Contact: Anson
Email: info@tianfuchem.com

16941-32-5

16941-32-5 structure

16941-32-5 structure

Name: glucagonTFA
Chemical Name: glucagon
CAS Number: 16941-32-5
Molecular Formula: C₁₅₃H₂₂₅N₄₃O₄₉S
Molecular Weight: 3482.747
Catalog: API Hormone and endocrine-regulating drugs Pancreatic hormones and other blood sugar regulating drugs
Create Date: 2018-07-10 11:00:43
Modify Date: 2026-07-01 21:46:23
Glucagon is a peptide hormone that helps regulate the blood sugar (glucose) levels in the body.

Name	glucagon
Synonyms	Glucagon, non animal source Glucagon rGlucagon (2 x 2.94 mg) (recombinant Glucagon (Human)) (COLD SHIPMENT REQUIRED) rGlucagon, recombinant glucagon (human) GLP-1, Insulinotropin His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr GlucagonQ: What is Glucagon Q: What is the CAS Number of Glucagon Q: What is the storage condition of Glucagon Q: What e the applications of Glucagon Glucagon RS GLUCAGON GlucagonTFA Glucagone Glucagon HCI Glukagon TFA Glucagon , bovine, human, rat, porcine piperazine-2,5-dione dioxime Glucagon Hydrochloride His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-g-g-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr GLUCAGON 37 GLUCAGON EXTRACTED FROM PORCINE*PANCREAS GAMMA-IRRA Glucagon 1-29 Glucagon (swine) 4-Amino-1-{5-O-[(9E)-9-octadecenoyl]-β-D-abinofuranosyl}-2(1H)- pyrimidinone Glucagon Hydrochlide Glucagon (human, rat, porcine) Glucagon (GLU) GLUCAGON FROM HOG PANCREAS, PACKAGE A Glucagon Human HCl Glucagon 4HCl L-Histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-α-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threonine Glucagon (HUMAN) (2 x 2.94 mg) (COLD SHIPMENT REQUIRED) Glucagon,Porcine glucagon Glucagon HCl L-Histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-α-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L -glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threonine OXYNTOMODULIN Glucagon Human Hydrochloride GASTRIN RELEASING PTIDE, PROCINE Glucagon impurity GlucaGen OXYNTOMODULIN (PORCINE) L-His-L-Ser-L-Gln-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Tyr-L-Ser-L-Lys-L-Tyr-L-Leu-L-Asp-L-Ser-L-g-L-g-L-Ala-L-Gln-L-Asp-L-Phe-L-Val-L-Gln-L-Trp-L-Leu-L-Met-L-Asn-L-Thr-OH Glucagon acetate HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-G-G-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-G-ASN-LYS-ASN-ASN-ILE-ALA-OH Glucagonum GLUCAGON 1-37 His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr GLUCAGON (PORCINE) Human Gucagon Glucagon //BP GLUCAGON ACETATE PORCINE GLUCAGON Glucagon Acetate/Hcl L-histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-α-aspartyl-L-seryl-N-(diaminomethylidene)-L-ornithyl-N-(diaminomethylidene)-L-ornithyl-L-alanyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threonine Glucagon , Human, Hydrochloride Salt Glucaton

Description	Glucagon is a peptide hormone that helps regulate the blood sugar (glucose) levels in the body.
Related Catalog	Signaling Pathways >> GPCR/G Protein >> Glucagon Receptor Research Areas >> Metabolic Disease Peptides Peptides
In Vitro	Glucagon corrects dyslipidemia, obesity, and hyperglycemia in DIO mice. When glucagon binds to the glucagon receptors, the liver cells convert the glycogen into individual glucose molecules and release them into the bloodstream, in a process known as glycogenolysis[1][2].
References	[1]. Finan B et al. Chemical Hybridization of Glucagon and Thyroid Hormone Optimizes Therapeutic Impact for Metabolic Disease. Cell. 2016 Oct 20;167(3):843-857. [2]. Kristensen PL et al. Impact of the TCF7L2 genotype on risk of hypoglycaemia and glucagon secretion during hypoglycaemia. Endocr Connect. 2016 Oct 10.

Density	1.5±0.1 g/cm3
Molecular Formula	C₁₅₃H₂₂₅N₄₃O₄₉S
Molecular Weight	3482.747
Exact Mass	3480.615723
PSA	1564.04000
LogP	-6.01
Appearance	powder
Index of Refraction	1.682
Storage condition	−20°C
Water Solubility	Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

Personal Protective Equipment	Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR	NONH for all modes of transport
WGK Germany	3

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.