Acetyl-β-Endorphin (human) trifluoroacetate salt

Modify Date: 2024-01-19 19:38:02

Acetyl-β-Endorphin (human) trifluoroacetate salt Structure
Acetyl-β-Endorphin (human) trifluoroacetate salt structure
Common Name Acetyl-β-Endorphin (human) trifluoroacetate salt
CAS Number 80102-04-1 Molecular Weight 3507.02000
Density N/A Boiling Point N/A
Molecular Formula C160H253N39O47S Melting Point N/A
MSDS N/A Flash Point N/A

 Use of Acetyl-β-Endorphin (human) trifluoroacetate salt


Acetyl-β-Endorphin (human) is a biologically active peptide.

 Names

Name ACETYL-β-ENDORPHIN (HUMAN)
Synonym More Synonyms

  Biological Activity

Description Acetyl-β-Endorphin (human) is a biologically active peptide.
Related Catalog

 Chemical & Physical Properties

Molecular Formula C160H253N39O47S
Molecular Weight 3507.02000
Exact Mass 3504.83000
PSA 1431.49000
LogP 4.32060

 Safety Information

WGK Germany 3

 Synonyms

AC-YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
AC-TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-ILE-LYS-ASN-ALA-TYR-LYS-LYS-GLY-GLU-OH
N-ac-B-endorphin
Top Suppliers:I want be here


Get all suppliers and price by the below link:

Acetyl-β-Endorphin (human) trifluoroacetate salt suppliers

Acetyl-β-Endorphin (human) trifluoroacetate salt price