Shanghai Nianxing Industrial Co., Ltd
China
Product Name: GastricInhibitoryPolypeptidehuman
Price: Check
Purity: 98.0%
Stocking Period: 10 Day
Contact: Yang
Email: sales@echemcloud.com

GL Biochem (Shanghai) Ltd.
China
Product Name: GIP, human
Price: $Inquiry/1kg
Purity: 98.0%
Stocking Period: 14 Day
Contact: Jackie Yang
Email: ymbetter@glbiochem.com

100040-31-1

100040-31-1 structure

100040-31-1 structure

Name: Gastric Inhibitory Polypeptide (human)
Chemical Name: Gastric Inhibitory Polypeptide human
CAS Number: 100040-31-1
Molecular Formula: C₂₂₆H₃₃₈N₆₀O₆₆S
Molecular Weight: 4983.53
Catalog: Peptides
Create Date: 2018-03-23 08:00:00
Modify Date: 2025-08-23 17:46:14
Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.

Name	Gastric Inhibitory Polypeptide human
Synonyms	MFCD00081634 GIP, human YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ Gastric Inhibitory Peptide (GIP), human

Description	Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.
Related Catalog	Signaling Pathways >> Others >> Others Research Areas >> Metabolic Disease Natural Products >> Others Peptides
In Vitro	Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state,sup>[1].
References	[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13.

Molecular Formula	C₂₂₆H₃₃₈N₆₀O₆₆S
Molecular Weight	4983.53
Storage condition	-20°C

Personal Protective Equipment	Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes	Xn
RIDADR	NONH for all modes of transport
WGK Germany	3.0

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.