Gastric Inhibitory Polypeptide (human)

Modify Date: 2025-08-23 17:46:14

Gastric Inhibitory Polypeptide (human) Structure
Gastric Inhibitory Polypeptide (human) structure
Common Name Gastric Inhibitory Polypeptide (human)
CAS Number 100040-31-1 Molecular Weight 4983.53
Density N/A Boiling Point N/A
Molecular Formula C226H338N60O66S Melting Point N/A
MSDS USA Flash Point N/A

 Use of Gastric Inhibitory Polypeptide (human)


Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.

 Names

Name Gastric Inhibitory Polypeptide human
Synonym More Synonyms

 Gastric Inhibitory Polypeptide (human) Biological Activity

Description Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.
Related Catalog
In Vitro Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state,sup>[1].
References

[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13.

 Chemical & Physical Properties

Molecular Formula C226H338N60O66S
Molecular Weight 4983.53
Storage condition -20°C

 Safety Information

Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes Xn
RIDADR NONH for all modes of transport
WGK Germany 3.0

 Articles7

More Articles
Long-term persistence of hormonal adaptations to weight loss.

N. Engl. J. Med. 365 , 1597-1604, (2011)

After weight loss, changes in the circulating levels of several peripheral hormones involved in the homeostatic regulation of body weight occur. Whether these changes are transient or persist over tim...

Pleiotropic effects of GIP on islet function involve osteopontin.

Diabetes 60 , 2424-2433, (2011)

The incretin hormone GIP (glucose-dependent insulinotropic polypeptide) promotes pancreatic β-cell function by potentiating insulin secretion and β-cell proliferation. Recently, a combined analysis of...

Gastric inhibitory polypeptide and its receptor are expressed in the central nervous system and support neuronal survival.

Cent. Nerv. Syst. Agents Med. Chem. 11 , 210-222, (2011)

The development of neuronal apoptosis depends on an intrinsic transcriptional program. By DNA microarray technology, we have previously implicated a number of genes in different paradigms of neuronal ...

 Synonyms

MFCD00081634
GIP, human
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Gastric Inhibitory Peptide (GIP), human
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
Top Suppliers:I want be here


Get all suppliers and price by the below link:

Gastric Inhibitory Polypeptide (human) suppliers


Price: $264/500ug

Reference only. check more Gastric Inhibitory Polypeptide (human) price