138398-61-5

138398-61-5 structure

Name: Amylin (8-37) (mouse, rat)
Chemical Name: amylin (8-37) (rat)
CAS Number: 138398-61-5
Molecular Formula: C₁₄₀H₂₂₇N₄₃O₄₃
Molecular Weight: 3200.56000
Catalog: Peptides
Create Date: 2018-12-17 16:43:43
Modify Date: 2024-01-02 20:27:22
Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.

Name	amylin (8-37) (rat)
Synonyms	Amylin (8-37) (mouse,rat) ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 diabetes associated peptide amide*fragment 8-37 R Amylin (8-37), rat

Description	Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.
Related Catalog	Signaling Pathways >> Others >> Others Research Areas >> Metabolic Disease Peptides
Target	Amylin receptor (AMY)[1]
In Vitro	Amylin (8-37), rat (Rat amylin-(8-37)) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Amylin (8-37) reduces plasma insulin (P<0.001) and enhances several measures of whole body and muscle insulin sensitivity (P<0.05) in both saline- and hGH-infused rats. Amylin-(8-37) corrects hGH-induced liver insulin resistance, increases basal plasma triglycerides and lowers plasma nonesterified fatty acids in both groups, and reduces muscle triglyceride and total long-chain acyl-CoA content in saline-treated rats (P<0.05). In isolated soleus muscle, Amylin (8-37) blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Thus 1) hyperamylinemia accompanies insulin resistance induced by hGH infusion; 2) Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin resistant rats; and 3) Amylin (8-37) elicits a significant alteration of in vivo lipid metabolism[2].
References	[1]. Bower RL, et al. Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br J Pharmacol. 2016 Jun;173(12):1883-98. [2]. Hettiarachchi M, et al. Rat amylin-(8-37) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Am J Physiol. 1997 Nov;273(5 Pt 1):E859-67.

Molecular Formula	C₁₄₀H₂₂₇N₄₃O₄₃
Molecular Weight	3200.56000
Exact Mass	3198.69000
PSA	1410.59000

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.

138398-61-5	178603-82-2
309244-90-4	1678415-03-6
1678414-88-4	178603-79-7
198277-54-2	135702-23-7
124447-81-0	155893-22-4
1186541-11-6	1186543-05-4
1186538-13-5	1341314-75-7
1186541-13-8	868283-50-5
1186539-86-5	1186541-12-7
1186539-82-1	1186538-76-0