Amylin (8-37) (mouse, rat)
Modify Date: 2024-01-02 20:27:22
Amylin (8-37) (mouse, rat) structure
|
Common Name | Amylin (8-37) (mouse, rat) | ||
|---|---|---|---|---|
| CAS Number | 138398-61-5 | Molecular Weight | 3200.56000 | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C140H227N43O43 | Melting Point | N/A | |
| MSDS | N/A | Flash Point | N/A | |
Use of Amylin (8-37) (mouse, rat)Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist. |
| Name | amylin (8-37) (rat) |
|---|---|
| Synonym | More Synonyms |
| Description | Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist. |
|---|---|
| Related Catalog | |
| Target |
Amylin receptor (AMY)[1] |
| In Vitro | Amylin (8-37), rat (Rat amylin-(8-37)) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Amylin (8-37) reduces plasma insulin (P<0.001) and enhances several measures of whole body and muscle insulin sensitivity (P<0.05) in both saline- and hGH-infused rats. Amylin-(8-37) corrects hGH-induced liver insulin resistance, increases basal plasma triglycerides and lowers plasma nonesterified fatty acids in both groups, and reduces muscle triglyceride and total long-chain acyl-CoA content in saline-treated rats (P<0.05). In isolated soleus muscle, Amylin (8-37) blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Thus 1) hyperamylinemia accompanies insulin resistance induced by hGH infusion; 2) Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin resistant rats; and 3) Amylin (8-37) elicits a significant alteration of in vivo lipid metabolism[2]. |
| References |
| Molecular Formula | C140H227N43O43 |
|---|---|
| Molecular Weight | 3200.56000 |
| Exact Mass | 3198.69000 |
| PSA | 1410.59000 |
| Amylin (8-37) (mouse,rat) |
| ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
| H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 |
| diabetes associated peptide amide*fragment 8-37 R |
| Amylin (8-37), rat |