Metabolic diseases is defined by a constellation of interconnected physiological, biochemical, clinical, and metabolic factors that directly increases the risk of cardiovascular disease, type 2 diabetes mellitus, and all cause mortality. Associated conditions include hyperuricemia, fatty liver (especially in concurrent obesity) progressing to nonalcoholic fatty liver disease, polycystic ovarian syndrome (in women), erectile dysfunction (in men), and acanthosis nigricans. Metabolic disease modeling is an essential component of biomedical research and a mandatory prerequisite for the treatment of human disease. Somatic genome editing using CRISPR/Cas9 might be used to establish novel metabolic disease models.


Anti-infection >
Arenavirus Bacterial CMV Enterovirus Filovirus Fungal HBV HCV HIV HSV Influenza Virus Parasite Reverse Transcriptase RSV SARS-CoV
Antibody-drug Conjugate >
ADC Cytotoxin ADC Linker Drug-Linker Conjugates for ADC PROTAC-linker Conjugate for PAC
Apoptosis >
Apoptosis Bcl-2 Family c-Myc Caspase DAPK Ferroptosis IAP MDM-2/p53 PKD RIP kinase Survivin Thymidylate Synthase TNF Receptor
Autophagy >
Autophagy LRRK2 ULK Mitophagy
Cell Cycle/DNA Damage >
Antifolate APC ATM/ATR Aurora Kinase Casein Kinase CDK Checkpoint Kinase (Chk) CRISPR/Cas9 Deubiquitinase DNA Alkylator/Crosslinker DNA-PK DNA/RNA Synthesis Eukaryotic Initiation Factor (eIF) G-quadruplex Haspin Kinase HDAC HSP IRE1 Kinesin LIM Kinase (LIMK) Microtubule/Tubulin Mps1 Nucleoside Antimetabolite/Analog p97 PAK PARP PERK Polo-like Kinase (PLK) PPAR RAD51 ROCK Sirtuin SRPK Telomerase TOPK Topoisomerase Wee1
Cytoskeleton >
Arp2/3 Complex Dynamin Gap Junction Protein Integrin Kinesin Microtubule/Tubulin Mps1 Myosin PAK
Epigenetics >
AMPK Aurora Kinase DNA Methyltransferase Epigenetic Reader Domain HDAC Histone Acetyltransferase Histone Demethylase Histone Methyltransferase JAK MicroRNA PARP PKC Sirtuin Protein Arginine Deiminase
GPCR/G Protein >
5-HT Receptor Adenosine Receptor Adenylate Cyclase Adiponectin Receptor Adrenergic Receptor Angiotensin Receptor Bombesin Receptor Bradykinin Receptor Cannabinoid Receptor CaSR CCR CGRP Receptor Cholecystokinin Receptor CRFR CXCR Dopamine Receptor EBI2/GPR183 Endothelin Receptor GHSR Glucagon Receptor Glucocorticoid Receptor GNRH Receptor GPCR19 GPR109A GPR119 GPR120 GPR139 GPR40 GPR55 GPR84 Guanylate Cyclase Histamine Receptor Imidazoline Receptor Leukotriene Receptor LPL Receptor mAChR MCHR1 (GPR24) Melatonin Receptor mGluR Motilin Receptor Neurokinin Receptor Neuropeptide Y Receptor Neurotensin Receptor Opioid Receptor Orexin Receptor (OX Receptor) Oxytocin Receptor P2Y Receptor Prostaglandin Receptor Protease-Activated Receptor (PAR) Ras RGS Protein Sigma Receptor Somatostatin Receptor TSH Receptor Urotensin Receptor Vasopressin Receptor Melanocortin Receptor
Immunology/Inflammation >
Aryl Hydrocarbon Receptor CCR Complement System COX CXCR FLAP Histamine Receptor IFNAR Interleukin Related IRAK MyD88 NO Synthase NOD-like Receptor (NLR) PD-1/PD-L1 PGE synthase Salt-inducible Kinase (SIK) SPHK STING Thrombopoietin Receptor Toll-like Receptor (TLR) Arginase
JAK/STAT Signaling >
EGFR JAK Pim STAT
MAPK/ERK Pathway >
ERK JNK KLF MAP3K MAP4K MAPKAPK2 (MK2) MEK Mixed Lineage Kinase MNK p38 MAPK Raf Ribosomal S6 Kinase (RSK)
Membrane Transporter/Ion Channel >
ATP Synthase BCRP Calcium Channel CFTR Chloride Channel CRAC Channel CRM1 EAAT2 GABA Receptor GlyT HCN Channel iGluR Monoamine Transporter Monocarboxylate Transporter Na+/Ca2+ Exchanger Na+/HCO3- Cotransporter Na+/K+ ATPase nAChR NKCC P-glycoprotein P2X Receptor Potassium Channel Proton Pump SGLT Sodium Channel TRP Channel URAT1
Metabolic Enzyme/Protease >
15-PGDH 5 alpha Reductase 5-Lipoxygenase Acetyl-CoA Carboxylase Acyltransferase Adenosine Deaminase Adenosine Kinase Aldehyde Dehydrogenase (ALDH) Aldose Reductase Aminopeptidase Angiotensin-converting Enzyme (ACE) ATGL ATP Citrate Lyase Carbonic Anhydrase Carboxypeptidase Cathepsin CETP COMT Cytochrome P450 Dipeptidyl Peptidase Dopamine β-hydroxylase E1/E2/E3 Enzyme Elastase Enolase FAAH FABP Factor Xa Farnesyl Transferase Fatty Acid Synthase (FAS) FXR Glucokinase GSNOR Gutathione S-transferase HCV Protease Hexokinase HIF/HIF Prolyl-Hydroxylase HIV Integrase HIV Protease HMG-CoA Reductase (HMGCR) HSP Indoleamine 2,3-Dioxygenase (IDO) Isocitrate Dehydrogenase (IDH) Lactate Dehydrogenase LXR MAGL Mineralocorticoid Receptor Mitochondrial Metabolism MMP Nampt NEDD8-activating Enzyme Neprilysin PAI-1 PDHK PGC-1α Phosphatase Phosphodiesterase (PDE) Phospholipase Procollagen C Proteinase Proteasome Pyruvate Kinase RAR/RXR Renin ROR Ser/Thr Protease SGK Stearoyl-CoA Desaturase (SCD) Thrombin Tryptophan Hydroxylase Tyrosinase Xanthine Oxidase
Neuronal Signaling >
5-HT Receptor AChE Adenosine Kinase Amyloid-β Beta-secretase CaMK CGRP Receptor COMT Dopamine Receptor Dopamine Transporter FAAH GABA Receptor GlyT iGluR Imidazoline Receptor mAChR Melatonin Receptor Monoamine Oxidase nAChR Neurokinin Receptor Opioid Receptor Serotonin Transporter γ-secretase
NF-κB >
NF-κB IKK Keap1-Nrf2 MALT1
PI3K/Akt/mTOR >
Akt AMPK ATM/ATR DNA-PK GSK-3 MELK mTOR PDK-1 PI3K PI4K PIKfyve PTEN
PROTAC >
PROTAC E3 Ligase Ligand-Linker Conjugate Ligand for E3 Ligase PROTAC Linker PROTAC-linker Conjugate for PAC
Protein Tyrosine Kinase/RTK >
Ack1 ALK Bcr-Abl BMX Kinase Btk c-Fms c-Kit c-Met/HGFR Discoidin Domain Receptor DYRK EGFR Ephrin Receptor FAK FGFR FLT3 IGF-1R Insulin Receptor IRAK Itk PDGFR PKA Pyk2 ROS Src Syk TAM Receptor Trk Receptor VEGFR
Stem Cell/Wnt >
Casein Kinase ERK Gli GSK-3 Hedgehog Hippo (MST) JAK Notch Oct3/4 PKA Porcupine ROCK sFRP-1 Smo STAT TGF-beta/Smad Wnt YAP β-catenin γ-secretase
TGF-beta/Smad >
TGF-beta/Smad PKC ROCK TGF-β Receptor
Vitamin D Related >
VD/VDR
Others >
Androgen Receptor Aromatase Estrogen Receptor/ERR Progesterone Receptor Thyroid Hormone Receptor Others

Bemfivastatin

Bemfivastatin (PPD 10558) is an orally active, HMG-CoA Reductase (HMGCR) inhibitor, also known as Statin. Bemfivastatin enhances the activity of liver extraction. Bemfivastatin exhibits little developmental toxicity effects in pregnant rats and rabbits via daily oral doses during organogenesis period. The no observed adverse effect level (NOAEL) are ≥320 mg/kg/day for rats developmental toxicity, 12.5 mg/kg/day for rabbits maternal toxicity, and 25 mg/kg/day for rabbits developmental toxicity, respectively. Bemfivastatin can be used for research on Statin-related hypercholesterolemic myalgia with inability to tolerate statins[1][2].

  • CAS Number: 805241-79-6
  • MF: C34H37FN2O6
  • MW: 588.67
  • Catalog: HMG-CoA Reductase (HMGCR)
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

α-Glucosidase-IN-29

α-Glucosidase-IN-29 (compound 19) is a α-glucosidases inhibitor (IC50=1.21 μM, Ki=1.80 μM). α-Glucosidase-IN-29 ca be used for research of diabetes and related diseases[1].

  • CAS Number: 2949513-11-3
  • MF: C33H30Br2O7
  • MW: 698.40
  • Catalog: Metabolic Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Glycyrin

Glycyrin is a PPAR-γ ligand of licorice. Glycyrin can decrease the blood glucose levels of genetically diabetic mice.Glycyrin also shows antibacterial activity[1][2][3].

  • CAS Number: 66056-18-6
  • MF: C22H22O6
  • MW: 382.41
  • Catalog: Bacterial
  • Density: 1.3±0.1 g/cm3
  • Boiling Point: 614.1±55.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 216.2±25.0 °C

2-Phenylglycine

2-Phenylglycine (DL-α-Phenylglycine) is a metabolite in breast milk during the W2 to W4 lactation period[1].

  • CAS Number: 2835-06-5
  • MF: C8H9NO2
  • MW: 151.163
  • Catalog: Metabolic Disease
  • Density: 1.2±0.1 g/cm3
  • Boiling Point: 288.7±28.0 °C at 760 mmHg
  • Melting Point: 121-127ºC
  • Flash Point: 128.4±24.0 °C

NKY 80

NKY80 is a potent, selective and non-competitive adenylyl cyclase (AC) type V isoform inhibitor with IC50s of 8.3 µM, 132 µM and 1.7 mM for type V, III and II, respectively. NKY80 is a non-nucleoside quinazolinone and regulates the AC catalytic activity in heart and lung tissues[1][2].

  • CAS Number: 299442-43-6
  • MF: C12H11N3O2
  • MW: 229.23500
  • Catalog: Adenylate Cyclase
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Exendin-4 Acetate

Exendin-4 acetate, a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.

  • CAS Number: 914454-01-6
  • MF: C186H286N50O62S
  • MW: 4246.62
  • Catalog: Peptides
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

L-Tryptophan-1-13C

L-Tryptophan-1-13C (Tryptophan-1-13C) is the 13C-labeled L-Tryptophan. L-Tryptophan (Tryptophan) is an essential amino acid that is the precursor of serotonin, melatonin, and vitamin B3[1].

  • CAS Number: 81201-92-5
  • MF: C1013CH12N2O2
  • MW: 205.22
  • Catalog: Metabolic Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

(R)-2-((4-Aminophenethyl)amino)-1-phenylethanol

Mirabegron impurity-1 is a potent and selectiveβ3- adrenergic receptor agonist. Mirabegron impurity-1has the activity of inhibiting metabolism. Mirabegron impurity-1 can be used inthe study of the treatment of bladder impurity [1].

  • CAS Number: 391901-45-4
  • MF: C16H20N2O
  • MW: 256.34
  • Catalog: Metabolic Disease
  • Density: 1.1±0.1 g/cm3
  • Boiling Point: 447.9±24.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 224.7±22.9 °C

Pparδ agonist 7

Pparδ agonist 7 is a potent agonist of Pparδ. The peroxisome proliferator-activated receptor (PPAR) is a member of the intranuclear receptor transcription factor superfamily that plays a key role in the regulation of metabolic homeostasis, inflammation, cell growth and differentiation in vivo. Pparδ agonist 7 has the potential for the research of non-alcoholic fatty liver disease (NAFLD) (extracted from patent WO2019105234A1, compound TM4)[1].

  • CAS Number: 2340432-40-6
  • MF: C25H25NO5
  • MW: 419.47
  • Catalog: PPAR
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Isorhamnetin-3-O-beta-D-Glucoside

Isorhamnetin-3-O-glucoside, a natural compound widely contained in many vegetables and rice, could be metabolized in intestinal microbiota after digestion[1].

  • CAS Number: 5041-82-7
  • MF: C22H22O12
  • MW: 478.403
  • Catalog: Metabolic Disease
  • Density: 1.8±0.1 g/cm3
  • Boiling Point: 834.4±65.0 °C at 760 mmHg
  • Melting Point: 155-160ºC
  • Flash Point: 291.3±27.8 °C

Tetramethylpyrazine

Tetramethylpyrazine (Ligustrazine), an alkylpyrazine isolated from Ligusticum wallichii (Chuan Xiong)[1], is present in french fries, bread, cooked meats, tea, cocoa, coffee, beer, spirits, peanuts, filberts, dairy products and soy products as fragrance and flavouring ingredienexhibits. Tetramethylpyrazine (Ligustrazine) also has potential nootropic and anti-inflammatory activities in rats[2][3].

  • CAS Number: 1124-11-4
  • MF: C8H12N2
  • MW: 136.19
  • Catalog: Cancer
  • Density: 1.0±0.1 g/cm3
  • Boiling Point: 192.7±35.0 °C at 760 mmHg
  • Melting Point: 77-80 °C(lit.)
  • Flash Point: 71.6±17.6 °C

SLx-4090

SLX-4090, an enterocytic-specific microsomal triglyceride transfer protein (MTP) inhibitor with an IC50 of 8.0 nM. SLX-4090 can be used for the research of dyslipidemia[1].

  • CAS Number: 913541-47-6
  • MF: C31H25F3N2O4
  • MW: 546.536
  • Catalog: Metabolic Disease
  • Density: 1.3±0.1 g/cm3
  • Boiling Point: 593.8±50.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 312.9±30.1 °C

Mitragynine pseudoindoxyl

Mitragynine pseudoindoxyl is a potent MOR agonist. Mitragynine pseudoindoxyl displays reduced hyperlocomotion, inhibition of GI transit and reinforcing properties[1].

  • CAS Number: 2035457-43-1
  • MF: C23H30N2O5
  • MW: 414.49
  • Catalog: Opioid Receptor
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

AdipoRon hydrochloride

AdipoRon hydrochloride is an orally active and specific AdipoR agonist, binding to AdipoR1 and AdipoR2, with Kds of 1.8 and 3.1 μM, respectively.

  • CAS Number: 1781835-20-8
  • MF: C27H29ClN2O3
  • MW: 464.984
  • Catalog: Adiponectin Receptor
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

AMPK activator 10

AMPK activator 10 is an orally active, potent AMPK activator with EC150 of 44.3 nM by cell-ELISA. AMPK activator 10 increases the phosphorylation levels of ACC. AMPK activator 10 exhibits a glucose lowering effect[1].

  • CAS Number: 1914176-03-6
  • MF: C24H26ClFN4O6
  • MW: 520.94
  • Catalog: AMPK
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

D-Xylulose-2-13C

D-Xylulose-2-13C is the 13C labeled D-Xylulose. D-xylulose is a precursor of the pentiol D-arabi[1][2].

  • CAS Number: 131771-47-6
  • MF: C5H10O5
  • MW: 151.12300
  • Catalog: Metabolic Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

α-Glucosidase-IN-9

α-Glucosidase-IN-9 (compound 7) is a potent α-glucosidase inhibitor, with an IC50 of 55.6 μM. α-Glucosidase-IN-9 can be used for type II diabetes research[1].

  • CAS Number: 735273-33-3
  • MF: C19H12N4OS
  • MW: 344.39
  • Catalog: Metabolic Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Phosphorylase purine nucleoside

Purine nucleoside phosphorylase is a key enzyme in purine metabolism, which is involved in the purine rescue pathway. The deficiency of Purine nucleoside phosphorylase resulted in impaired T cell function. In the presence of inorganic orthophosphate as the second substrate, Purine nucleoside phosphorylase catalyzes the breaking of the glycosidic bond between ribose and deoxyribonucleoside to generate purine base and ribose (deoxyribose) -1-phosphate[1].

  • CAS Number: 9030-21-1
  • MF: C5H6ClN3
  • MW: 143.574
  • Catalog: Metabolic Disease
  • Density: 1.4±0.1 g/cm3
  • Boiling Point: 409.3±40.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 201.3±27.3 °C

Neopuerarin A

Neopuerarin A is an isoflavones isolated from the water extraction of the dried roots of Pueraria lobata (Willd.). Neopuerarin A shows significant hepatoprotective effect[1].

  • CAS Number: 1150314-34-3
  • MF: C21H20O9
  • MW: 416.38
  • Catalog: Metabolic Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

CI 583

Meclofenamic acid (Meclofenamate) sodium hydrate is a non-steroidal anti-inflammatory agent. Meclofenamic acid sodium hydrate is a highly selective FTO (fat mass and obesity-associated) enzyme inhibitor. Meclofenamic acid sodium hydrate competes with FTO binding for the m(6)A-containing nucleic acid. Meclofenamic acid sodium hydrate is a non-selective gap-junction blocker. Meclofenamic acid sodium hydrate inhibits hKv2.1 and hKv1.1, with IC50 values of 56.0 and 155.9 μM, respectively[1][2][3][4].

  • CAS Number: 67254-91-5
  • MF: C14H12Cl2NNaO3
  • MW: 336.14600
  • Catalog: Gap Junction Protein
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

ACTH (4-10)

Adrenocorticotropic Hormone (ACTH) (4-10), human is a melanocortin 4 (MC4R) receptor agonist.

  • CAS Number: 4037-01-8
  • MF: C44H59N13O10S
  • MW: 962.09
  • Catalog: Peptides
  • Density: 1.48g/cm3
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Picornain 3C

Picornain 3C is a protease found in picornaviruses, which cleaves peptide bonds of non-terminal sequences. Picornain 3C is an intermediate between the serine peptidase chymotrypsin and the cysteine peptidase papain. Picornain 3C shows endopeptidase activity by selectively cleaving Gln-Gly bonds in the polyprotein of poliovirus and with substitution of Glu for Gln, and Ser or Thr for Gly in other picornaviruses[1].

  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

10-Nitrolinoleic acid

10-Nitrolinoleic acid is a potent peroxisome proliferator-activated receptor γ (PPARγ) agonist. 10-Nitrolinoleic acid competes with [3H]Rosiglitazone for binding to PPAR-γ, with an IC50 of 0.22 μM[1].

  • CAS Number: 774603-04-2
  • MF: C18H31NO4
  • MW: 325.443
  • Catalog: PPAR
  • Density: 1.0±0.1 g/cm3
  • Boiling Point: 452.2±33.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 173.9±13.8 °C

Epimedin K

Epimedin K (Korepimedoside B), a flavonol glycoside, is isolated from the aerial parts of Epimedium koreanum Nakai. Epimedium koreanum Nakai is a famous Chinese herbal medicine for the research of impotence, osteoporosis, immune suppression and cardiovascular diseases[1][2].

  • CAS Number: 174286-13-6
  • MF: C45H56O23
  • MW: 964.91200
  • Catalog: Cardiovascular Disease
  • Density: 1.53g/cm3
  • Boiling Point: 1080.5ºC at 760mmHg
  • Melting Point: N/A
  • Flash Point: 313.9ºC

Imidazol-1-yl-acetic acid

Imidazol-1-yl-acetic acid is an endogenous metabolite.

  • CAS Number: 22884-10-2
  • MF: C5H6N2O2
  • MW: 126.113
  • Catalog: Metabolic Disease
  • Density: 1.3±0.1 g/cm3
  • Boiling Point: 392.1±25.0 °C at 760 mmHg
  • Melting Point: 257-260 ºC
  • Flash Point: 190.9±23.2 °C

Dulaglutide

Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.

  • CAS Number: 923950-08-7
  • MF: C149H221N37O49
  • MW: 3314.62
  • Catalog: Peptides
  • Density: 1.4±0.1 g/cm3
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

glucagon receptor antagonists-1

Glucagon receptor antagonists-1 is a highly potent glucagon receptor antagonist.

  • CAS Number: 503559-84-0
  • MF: C29H34FNO2
  • MW: 447.58400
  • Catalog: Glucagon Receptor
  • Density: 1.094
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

SM-2470

SM-2470 is a potent α1-adrenoceptor antagonist, has sympathetic nerve activity in anesthetized rats[1]. SM-2470 is an antihypertensive agent. SM-2470 exhibits hypocholesterolaemic effect by the inhibition of cholesterol absorption related to the reduction of cholesterol solubilization[2].

  • CAS Number: 99899-45-3
  • MF: C23H30ClN5O3
  • MW: 459.97
  • Catalog: Adrenergic Receptor
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Pseudoprotodioscin

Pseudoprotodioscin, a furostanoside, inhibits SREBP1/2 and microRNA 33a/b levels and reduces the gene expression regarding the synthesis of cholesterol and triglycerides[1].

  • CAS Number: 102115-79-7
  • MF: C51H82O21
  • MW: 1031.184
  • Catalog: MicroRNA
  • Density: 1.45 g/cm3
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Diprotin A

Diprotin A (Ile-Pro-Ile) is an inhibitor of dipeptidyl peptidase IV (DPP-IV)[1].

  • CAS Number: 90614-48-5
  • MF: C17H31N3O4
  • MW: 341.44600
  • Catalog: Dipeptidyl Peptidase
  • Density: 1.14 g/cm3
  • Boiling Point: 583.1ºC at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 306.5ºC