A range of neurological disorders, including epilepsy and dystonia, may involve dysfunctional intracortical inhibition, and may respond to treatments that modify it. Parkinson’s is a neurodegenerative disease characterized by increased activity of GABA in basal ganglia and the loss of dopamine in nigrostriatum, associated with rigidity, resting tremor, gait with accelerating steps, and fixed inexpressive face. Neurological deficits, along with neuromuscular involvement, are characteristic of mitochondrial disease, and these symptoms can have a dramatic impact on patient quality of life. Neurological features may be manifold, ranging from neural deafness, ataxia, peripheral neuropathy, migraine, seizures, stroke‐like episodes and dementia and depend on the part of the nervous system affected.


Anti-infection >
Arenavirus Bacterial CMV Enterovirus Filovirus Fungal HBV HCV HIV HSV Influenza Virus Parasite Reverse Transcriptase RSV SARS-CoV
Antibody-drug Conjugate >
ADC Cytotoxin ADC Linker Drug-Linker Conjugates for ADC PROTAC-linker Conjugate for PAC
Apoptosis >
Apoptosis Bcl-2 Family c-Myc Caspase DAPK Ferroptosis IAP MDM-2/p53 PKD RIP kinase Survivin Thymidylate Synthase TNF Receptor
Autophagy >
Autophagy LRRK2 ULK Mitophagy
Cell Cycle/DNA Damage >
Antifolate APC ATM/ATR Aurora Kinase Casein Kinase CDK Checkpoint Kinase (Chk) CRISPR/Cas9 Deubiquitinase DNA Alkylator/Crosslinker DNA-PK DNA/RNA Synthesis Eukaryotic Initiation Factor (eIF) G-quadruplex Haspin Kinase HDAC HSP IRE1 Kinesin LIM Kinase (LIMK) Microtubule/Tubulin Mps1 Nucleoside Antimetabolite/Analog p97 PAK PARP PERK Polo-like Kinase (PLK) PPAR RAD51 ROCK Sirtuin SRPK Telomerase TOPK Topoisomerase Wee1
Cytoskeleton >
Arp2/3 Complex Dynamin Gap Junction Protein Integrin Kinesin Microtubule/Tubulin Mps1 Myosin PAK
Epigenetics >
AMPK Aurora Kinase DNA Methyltransferase Epigenetic Reader Domain HDAC Histone Acetyltransferase Histone Demethylase Histone Methyltransferase JAK MicroRNA PARP PKC Sirtuin Protein Arginine Deiminase
GPCR/G Protein >
5-HT Receptor Adenosine Receptor Adenylate Cyclase Adiponectin Receptor Adrenergic Receptor Angiotensin Receptor Bombesin Receptor Bradykinin Receptor Cannabinoid Receptor CaSR CCR CGRP Receptor Cholecystokinin Receptor CRFR CXCR Dopamine Receptor EBI2/GPR183 Endothelin Receptor GHSR Glucagon Receptor Glucocorticoid Receptor GNRH Receptor GPCR19 GPR109A GPR119 GPR120 GPR139 GPR40 GPR55 GPR84 Guanylate Cyclase Histamine Receptor Imidazoline Receptor Leukotriene Receptor LPL Receptor mAChR MCHR1 (GPR24) Melatonin Receptor mGluR Motilin Receptor Neurokinin Receptor Neuropeptide Y Receptor Neurotensin Receptor Opioid Receptor Orexin Receptor (OX Receptor) Oxytocin Receptor P2Y Receptor Prostaglandin Receptor Protease-Activated Receptor (PAR) Ras RGS Protein Sigma Receptor Somatostatin Receptor TSH Receptor Urotensin Receptor Vasopressin Receptor Melanocortin Receptor
Immunology/Inflammation >
Aryl Hydrocarbon Receptor CCR Complement System COX CXCR FLAP Histamine Receptor IFNAR Interleukin Related IRAK MyD88 NO Synthase NOD-like Receptor (NLR) PD-1/PD-L1 PGE synthase Salt-inducible Kinase (SIK) SPHK STING Thrombopoietin Receptor Toll-like Receptor (TLR) Arginase
JAK/STAT Signaling >
EGFR JAK Pim STAT
MAPK/ERK Pathway >
ERK JNK KLF MAP3K MAP4K MAPKAPK2 (MK2) MEK Mixed Lineage Kinase MNK p38 MAPK Raf Ribosomal S6 Kinase (RSK)
Membrane Transporter/Ion Channel >
ATP Synthase BCRP Calcium Channel CFTR Chloride Channel CRAC Channel CRM1 EAAT2 GABA Receptor GlyT HCN Channel iGluR Monoamine Transporter Monocarboxylate Transporter Na+/Ca2+ Exchanger Na+/HCO3- Cotransporter Na+/K+ ATPase nAChR NKCC P-glycoprotein P2X Receptor Potassium Channel Proton Pump SGLT Sodium Channel TRP Channel URAT1
Metabolic Enzyme/Protease >
15-PGDH 5 alpha Reductase 5-Lipoxygenase Acetyl-CoA Carboxylase Acyltransferase Adenosine Deaminase Adenosine Kinase Aldehyde Dehydrogenase (ALDH) Aldose Reductase Aminopeptidase Angiotensin-converting Enzyme (ACE) ATGL ATP Citrate Lyase Carbonic Anhydrase Carboxypeptidase Cathepsin CETP COMT Cytochrome P450 Dipeptidyl Peptidase Dopamine β-hydroxylase E1/E2/E3 Enzyme Elastase Enolase FAAH FABP Factor Xa Farnesyl Transferase Fatty Acid Synthase (FAS) FXR Glucokinase GSNOR Gutathione S-transferase HCV Protease Hexokinase HIF/HIF Prolyl-Hydroxylase HIV Integrase HIV Protease HMG-CoA Reductase (HMGCR) HSP Indoleamine 2,3-Dioxygenase (IDO) Isocitrate Dehydrogenase (IDH) Lactate Dehydrogenase LXR MAGL Mineralocorticoid Receptor Mitochondrial Metabolism MMP Nampt NEDD8-activating Enzyme Neprilysin PAI-1 PDHK PGC-1α Phosphatase Phosphodiesterase (PDE) Phospholipase Procollagen C Proteinase Proteasome Pyruvate Kinase RAR/RXR Renin ROR Ser/Thr Protease SGK Stearoyl-CoA Desaturase (SCD) Thrombin Tryptophan Hydroxylase Tyrosinase Xanthine Oxidase
Neuronal Signaling >
5-HT Receptor AChE Adenosine Kinase Amyloid-β Beta-secretase CaMK CGRP Receptor COMT Dopamine Receptor Dopamine Transporter FAAH GABA Receptor GlyT iGluR Imidazoline Receptor mAChR Melatonin Receptor Monoamine Oxidase nAChR Neurokinin Receptor Opioid Receptor Serotonin Transporter γ-secretase
NF-κB >
NF-κB IKK Keap1-Nrf2 MALT1
PI3K/Akt/mTOR >
Akt AMPK ATM/ATR DNA-PK GSK-3 MELK mTOR PDK-1 PI3K PI4K PIKfyve PTEN
PROTAC >
PROTAC E3 Ligase Ligand-Linker Conjugate Ligand for E3 Ligase PROTAC Linker PROTAC-linker Conjugate for PAC
Protein Tyrosine Kinase/RTK >
Ack1 ALK Bcr-Abl BMX Kinase Btk c-Fms c-Kit c-Met/HGFR Discoidin Domain Receptor DYRK EGFR Ephrin Receptor FAK FGFR FLT3 IGF-1R Insulin Receptor IRAK Itk PDGFR PKA Pyk2 ROS Src Syk TAM Receptor Trk Receptor VEGFR
Stem Cell/Wnt >
Casein Kinase ERK Gli GSK-3 Hedgehog Hippo (MST) JAK Notch Oct3/4 PKA Porcupine ROCK sFRP-1 Smo STAT TGF-beta/Smad Wnt YAP β-catenin γ-secretase
TGF-beta/Smad >
TGF-beta/Smad PKC ROCK TGF-β Receptor
Vitamin D Related >
VD/VDR
Others >
Androgen Receptor Aromatase Estrogen Receptor/ERR Progesterone Receptor Thyroid Hormone Receptor Others

Cyamemazine

Cyamemazine is a neuroleptic agent that contains the phenothiazine chromophore. Cyamemazine is often used as an anxiolytic. Cyamemazine is a potent 5-HT3 (Ki of 12 nM), 5-HT2A (Ki = 1.5 nM) and 5-HT2C (Ki of 75 nM) receptors antagonist with antipsychotic activity[1][2].

  • CAS Number: 3546-03-0
  • MF: C19H21N3S
  • MW: 323.455
  • Catalog: 5-HT Receptor
  • Density: 1.2±0.1 g/cm3
  • Boiling Point: 479.0±45.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 243.5±28.7 °C

PAP

Phenthoate is an organophosphorus pesticide having low toxicity in animals. Phenthoate is also a AChE inhibitor[1][2].

  • CAS Number: 2597-03-7
  • MF: C12H17O4PS2
  • MW: 320.365
  • Catalog: AChE
  • Density: 1.3±0.1 g/cm3
  • Boiling Point: 379.5±52.0 °C at 760 mmHg
  • Melting Point: 156ºC
  • Flash Point: 183.3±30.7 °C

A 784168

A-784168 is a potent and orally active inhibitor of vanilloid receptor type 1 (TRPV1). Vanilloid receptor type 1 (TRPV1) is a ligand-gated nonselective cation channel that is considered to be an important integrator of various pain stimuli such as endogenous lipids, capsaicin, heat, and low pH. A-784168 has good CNS penetration[1].

  • CAS Number: 824982-41-4
  • MF: C19H15F6N3O3S
  • MW: 479.39600
  • Catalog: TRP Channel
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

DREADD Agonist 21

DREADD agonist 21 is a potent human muscarinic acetylcholine M3 receptors (hM3Dq) agonist(EC50=1.7 nM).

  • CAS Number: 56296-18-5
  • MF: C17H18N4
  • MW: 278.352
  • Catalog: mAChR
  • Density: 1.3±0.1 g/cm3
  • Boiling Point: 470.1±55.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 238.1±31.5 °C

Iptakalim hydrochloride

Iptakalim hydrochloride, a lipophilic para-amino compound, is a novel ATP-sensitive potassium channel (KATP) opener, as well as an α4β2-containing nicotinic acetylcholine receptor (nAChR) antagonist[1].

  • CAS Number: 642407-63-4
  • MF: C9H22ClN
  • MW: 179.73
  • Catalog: nAChR
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

PHACLOFEN

Phaclofen is a selective GABAB receptor antagonist. Phaclofen is a peripheral and central baclofen antagonist. Phaclofen maybe a potential compound in determining the physiological significance of central and peripheral bicuculline-insensitive receptors with which GABA and (-)-baclofen interact[1][2].

  • CAS Number: 114012-12-3
  • MF: C9H13ClNO3P
  • MW: 249.63100
  • Catalog: GABA Receptor
  • Density: 1.432 g/cm3
  • Boiling Point: 467.1ºC at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 236.3ºC

SCH 221510

SCH 221510 is a potent, orally active and selective NOP (nociceptin opioid receptor) agonist, with an EC50 of 12 nM and Ki of 0.3 nM. SCH 221510 shows an anxiolytic-like effect[1].

  • CAS Number: 322473-89-2
  • MF: C28H31NO
  • MW: 397.55
  • Catalog: Opioid Receptor
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

(4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,7,9-trihydroxy-N-[2-(3-phenyl-1,2,4-oxadiazol-5-yl)propan-2-yl]-1,2,4,5,7a,13-hexahydro-4,12-methanobenzofuro[3,2-e]isoquinoline-6-carboxamide,4-methylbenzenesulfonic acid

Naldemedine (S-297995) tosylate is an orally active μ-opioid receptor antagonist (PAMORA)[1]. Naldemedine tosylate shows potent binding affinities (Ki=0.34, 0.43, 0.94 nM, respectively) and antagonist activities (IC50=25.57, 7.09, 16.1 nM, respectively) for recombinant human μ-, δ-, and κ- opioid receptors[2]. Naldemedine can be used in opioid-induced constipation (OIC) research[2]. Naldemedine tosylate is predicted to bind to 3CLpro encoded by SARS-CoV2 genome[3].

  • CAS Number: 1345728-04-2
  • MF: C39H42N4O9S
  • MW: 742.83700
  • Catalog: Opioid Receptor
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Succinic acid-13C2

Succinic acid-13C2 is the 13C labeled Succinic acid[1]. Succinic acid is a potent and orally active anxiolytic agent. Succinic acid is an intermediate product of the tricarboxylic acid cycle. Succinic acid can be used as a precursor of many industrially important chemicals in food, chemical and pharmaceutical industries[2][3].

  • CAS Number: 61128-08-3
  • MF: C4H6O4
  • MW: 120.07300
  • Catalog: Neurological Disease
  • Density: 1.408g/cm3
  • Boiling Point: 235ºC
  • Melting Point: 187-190ºC(lit.)
  • Flash Point: N/A

Vilazodone Hydrochloride

Vilazodone Hydrochloride is a serotonin transporter (SER) inhibitor and 5-HT1A receptor partial agonist.

  • CAS Number: 163521-08-2
  • MF: C26H28ClN5O2
  • MW: 477.98600
  • Catalog: 5-HT Receptor
  • Density: N/A
  • Boiling Point: 745.1ºC at 760 mmHg
  • Melting Point: 279°C(lit.)
  • Flash Point: 404.4ºC

(+)-Igmesine hydrochloride

(+)-Igmesine hydrochloride (JO1784) is an orally active and selective σ receptor ligand with neuroprotective and anti-amnesic activities[1].

  • CAS Number: 130152-35-1
  • MF: C23H30ClN
  • MW: 355.94
  • Catalog: Sigma Receptor
  • Density: 1.027g/cm3
  • Boiling Point: 445.1ºC at 760mmHg
  • Melting Point: N/A
  • Flash Point: 196.9ºC

Isorosmanol

Isorosmanol is an abietane-type diterpene isolated from the leaves of sage, with antioxidant, neuroprotective and neurotrophic effects. Isorosmanol inhibits AChE activity and melanin synthesis[1][2][3].

  • CAS Number: 93780-80-4
  • MF: C20H26O5
  • MW: 346.41700
  • Catalog: AChE
  • Density: 1.33±0.1 g/cm3 (20 °C, 760 mmHg)
  • Boiling Point: 569.5±50.0 °C (760 mmHg)
  • Melting Point: N/A
  • Flash Point: N/A

Cerlapirdine

Cerlapirdine (SAM-531, PF-05212365) is a selective and potent full antagonist of the 5-hydroxytryptamine 6 (5-HT6) receptor. Cerlapirdine has the potential for researching the Alzheimer's disease[1].

  • CAS Number: 925448-93-7
  • MF: C22H23N3O3S
  • MW: 409.50100
  • Catalog: 5-HT Receptor
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

TP-030-1

TP-030-1 is an inhibitor of RIPK1. TP-030-1 inhibits hRIPK1 with a Ki value of 3.9 nM and inhibits mRIPK1 with an IC50 value of 4.2 μM. TP-030-1 can be used for the research of inflammatory diseases and neurodegenerative diseases[1].

  • CAS Number: 2095514-75-1
  • MF: C23H22N4O3
  • MW: 402.45
  • Catalog: RIP kinase
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

SR 58611A hydrochloride

Amibegron hydrochloride is a selective β3-adrenoceptor agonist, with an EC50 of 3.5 nM for β-adrenoceptor in rat colon; Amibegron hydrochloride has anxiolytic and antidepressant activity.

  • CAS Number: 121524-09-2
  • MF: C22H27Cl2NO4
  • MW: 440.36000
  • Catalog: Adrenergic Receptor
  • Density: N/A
  • Boiling Point: 576ºC at 760mmHg
  • Melting Point: N/A
  • Flash Point: 302.2ºC

Irdabisant hydrochloride

Irdabisant (CEP-26401) hydrochloride is a selective, orally active and blood-brain barrier (BBB) penetrant histamine H3 receptor (H3R) inverse agonist/inverse agonist with Ki values of 7.2 nM and 2.0 nM for rat H3R and human H3R, respectively. Irdabisant hydrochloride has relatively low inhibitory activity against hERG current with an IC50 of 13.8 μM. Irdabisant hydrochloride has cognition-enhancing and wake-promoting activities in the rat social recognition model. Irdabisant hydrochloride can be used to research schizophrenia or cognitive impairment[1][2].

  • CAS Number: 1005398-61-7
  • MF: C18H24ClN3O2
  • MW: 349.85500
  • Catalog: Histamine Receptor
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Piridocaine hydrochloride

Piridocaine hydrochloride (Lucaine hydrochloride) is a piperidyl propanol ester of orthoaminobenzoic acid used as a local anesthetic drug.

  • CAS Number: 6099-95-2
  • MF: C14H21ClN2O2
  • MW: 284.78
  • Catalog: Neurological Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Imperatorin

Imperatorin is an effective of NO synthesis inhibitor (IC50=9.2 μmol), which also is a BChE inhibitor (IC50=31.4 μmol). Imperatorin is a weak agonist of TRPV1 with EC50 of 12.6±3.2 μM.

  • CAS Number: 482-44-0
  • MF: C16H14O4
  • MW: 270.280
  • Catalog: TRP Channel
  • Density: 1.2±0.1 g/cm3
  • Boiling Point: 448.3±45.0 °C at 760 mmHg
  • Melting Point: 98-100ºC
  • Flash Point: 224.9±28.7 °C

SUN 11602

SUN11602 is a novel aniline compound with basic fibroblast growth factor-like activity.

  • CAS Number: 704869-38-5
  • MF: C26H37N5O2
  • MW: 451.60
  • Catalog: Neurological Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

ALS-I

ALS-I, an acid-Liable surfactant, is adopted for in-solution enzymatic digestions, can help to solubilize hydrophobic proteins. ALS-I is significantly enhanced peptide recovery for mass spectrometry (MS) mapping in the study of the proteomes of regenerating rat retina and mouse brain[1][2].

  • CAS Number: 308818-13-5
  • MF: C19H37NaO6S
  • MW: 416.54800
  • Catalog: Neurological Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

E-64d

Aloxistatin (E64d) is a cell-permeable and irreversible broad-spectrum cysteine protease inhibitor.

  • CAS Number: 88321-09-9
  • MF: C17H30N2O5
  • MW: 342.431
  • Catalog: Cathepsin
  • Density: 1.2±0.1 g/cm3
  • Boiling Point: 470.5±55.0 °C at 760 mmHg
  • Melting Point: 126.2°C
  • Flash Point: 238.4±31.5 °C

Asoxime dichloride

Asoxime dichloride (HI-6) is an antagonist to acetylcholine receptors (AChRs) including the nicotinic receptor, α7 nAChR. Asoxime dichloride involves in modulating immunity response. Asoxime dichloride (HI-6) can be used as an antigen and improves vaccination efficacy in the nervous system[1].

  • CAS Number: 34433-31-3
  • MF: C14H16Cl2N4O3
  • MW: 359.20800
  • Catalog: nAChR
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: 145-147ºC
  • Flash Point: N/A

PF-06751979

PF-06751979 is a potent, brain penetrant, β-site amyloid precursor protein cleaving enzyme 1 (BACE1) inhibitor with an IC50 of 7.3 nM in BACE1 binding assay.

  • CAS Number: 1818339-66-0
  • MF: C18H19F2N5O3S2
  • MW: 455.5
  • Catalog: Beta-secretase
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

ELN 318463

ELN 318463 is an amyloid precursor protein (APP) selective γ-secretase inhibitor. ELN 318463 shows differential inhibition of presenilin (PS1)- and PS2-comprised γ-secretase with EC50s of 12 nM and 656 nM for PS1 and PS2, respectively. ELN 318463 is 51-fold more selective for PS1[1][2].

  • CAS Number: 851600-86-7
  • MF: C19H20BrClN2O3S
  • MW: 471.80
  • Catalog: Neurological Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Bryostatin 1

Bryostatin 1 is a natural macrolide isolated from the bryozoan Bugula neritina and is a potent and central nervous system (CNS)-permeable PKC modulator. Bryostatin 1 binds to the isolated C1 domain of Munc13-1 and the full-length Munc13-1 protein with Kis of 8.07 nM and 0.45 nM, respectively. Bryostatin 1 has anti-cancer, anti-inflammatory, neuroprotective, anti-HIV-1 infection properties[1][2][3][4].

  • CAS Number: 83314-01-6
  • MF: C47H68O17
  • MW: 905.033
  • Catalog: HIV
  • Density: 1.3±0.1 g/cm3
  • Boiling Point: 954.7±65.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 270.0±27.8 °C

Loureirin C

Loureirin C, isolated from "Dragon’s blood", which is a deep red resin obtained from a variety of plant sources. The resin extracted from stems of Dracaena cochinchinensis is one such source of “dragon’s blood”, has a reputation for facilitating blood circulation and dispersing blood stasis. The resin has anti-bacterial, anti-spasmodic, anti-inflammatory, analgesic, anti-diabetic, and anti-tumor activities[1].

  • CAS Number: 116384-24-8
  • MF: C16H16O4
  • MW: 272.296
  • Catalog: Cancer
  • Density: 1.2±0.1 g/cm3
  • Boiling Point: 503.4±45.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 189.6±22.2 °C

TREM2 agonist-2

TREM2 agonist-2 (I-192) is an orally active triggering receptor expressed on myeloid cells 2 (TREM2) agonist (EC50<0.05 μM)[1].

  • CAS Number: 2738485-98-6
  • MF: C24H23ClFN5O
  • MW: 451.92
  • Catalog: Neurological Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain[1].

  • CAS Number: 2279952-25-7
  • MF: C171H250N40O39
  • MW: 3490.06
  • Catalog: Neurological Disease
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Tetracaine

Tetracaine is a topical local anesthetic for the eyes; works by interfering with entry of sodium ions into nerve cells.

  • CAS Number: 94-24-6
  • MF: C15H24N2O2
  • MW: 264.363
  • Catalog: Sodium Channel
  • Density: 1.0±0.1 g/cm3
  • Boiling Point: 389.4±27.0 °C at 760 mmHg
  • Melting Point: 43 °C
  • Flash Point: 189.3±23.7 °C

Paederosidic acid methyl ester

Paederosidic acid methyl ester is a ATP‐sensitive K+ channel activator, isolated from P. scandens. Paederosidic acid methyl ester exhibits significant central analgesic activity, and enhances the threshold of pain by activating ATP‐sensitive K+ channel in the brain and spinal cord level[1].

  • CAS Number: 122413-01-8
  • MF: C19H26O12S
  • MW: 478.467
  • Catalog: Potassium Channel
  • Density: 1.6±0.1 g/cm3
  • Boiling Point: 711.2±70.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 383.9±35.7 °C